dbACP: A Comprehensive Database of Anti-Cancer Peptides

18 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01172 Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Apoptosis inducing Not specified CLL Leukemia IC50 : 0.7 ± 0.1 µM
dbacp01173 Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Apoptosis inducing Not specified MEC-1 Leukemia IC50 : 2.5 ± 0.1 µM
dbacp02625 D-N-Ter-Antp MAVPPTYADLGKSARDVFTKGYGFGLRQIKIWFQNRRMKWKK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 1.5 ± 0.6 µM
dbacp02626 D-N-Ter-Antp MAVPPTYADLGKSARDVFTKGYGFGLRQIKIWFQNRRMKWKK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 2.2 ± 1.6 µM
dbacp04287 LP-4 peptide SWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia Not found
dbacp04288 LP-4 peptide SWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia Not found
dbacp04683 Min-Antp-LP4 KRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 0.3 ± 0.1 µM
dbacp04684 Min-Antp-LP4 KRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 1.7 ± 0.4 µM
dbacp04790 N-Ter RDVFTKGYGFGL VDAC1(voltage-dependent anion channel1) Inducing apoptosis SRB assay A375 Human endometrial cancer IC50 : > 50.0 μM
dbacp04791 N-Ter-Antp N-Ter-RQIKIWFQNRRMKWKK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 3.2 ± 0.5 µM
dbacp04792 N-Ter-Antp N-Ter-RQIKIWFQNRRMKWKK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 4.2 ± 0.2 µM
dbacp04793 N-Ter-TAT RDVFTKGYGFGLGRKKRRQRRRPQ VDAC1(voltage-dependent anion channel1) Inducing apoptosis SRB assay A375 Human endometrial cancer IC50 : > 50.0 μM
dbacp05129 Pal-N-Ter-TAT RDVFTKGYGFGLGRKKRRQRRRPQ VDAC1(voltage-dependent anion channel1) Inducing apoptosis SRB assay A375 Human endometrial cancer IC50 : 15.2 ± 0.7 μM
dbacp05130 Pal-pFL-N-Ter-TAT FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ VDAC1(voltage-dependent anion channel1) Inducing apoptosis MTT assay A375 Leukemia IC50 : 5.5 ± 1.1 μM
dbacp06301 Tf-D-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 1.2 ± 0.1 µM
dbacp06302 Tf-D-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 1.8 ± 0.2 µM
dbacp06303 Tf-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 1.7 ± 0.2 µM
dbacp06304 Tf-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 3.6 ± 0.2 µM