23 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01172 | Antp-LP4 | RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Apoptosis inducing | Not specified | CLL | Leukemia | IC50 : 0.7 ± 0.1 µM |
| dbacp01173 | Antp-LP4 | RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Apoptosis inducing | Not specified | MEC-1 | Leukemia | IC50 : 2.5 ± 0.1 µM |
| dbacp02625 | D-N-Ter-Antp | MAVPPTYADLGKSARDVFTKGYGFGLRQIKIWFQNRRMKWKK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | CLL | Leukemia | IC50 : 1.5 ± 0.6 µM |
| dbacp02626 | D-N-Ter-Antp | MAVPPTYADLGKSARDVFTKGYGFGLRQIKIWFQNRRMKWKK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | MEC-1 | Leukemia | IC50 : 2.2 ± 1.6 µM |
| dbacp04287 | LP-4 peptide | SWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | CLL | Leukemia | Not found |
| dbacp04288 | LP-4 peptide | SWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | MEC-1 | Leukemia | Not found |
| dbacp04683 | Min-Antp-LP4 | KRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | CLL | Leukemia | IC50 : 0.3 ± 0.1 µM |
| dbacp04684 | Min-Antp-LP4 | KRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | MEC-1 | Leukemia | IC50 : 1.7 ± 0.4 µM |
| dbacp04790 | N-Ter | RDVFTKGYGFGL | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | SRB assay | A375 | Human endometrial cancer | IC50 : > 50.0 μM |
| dbacp04791 | N-Ter-Antp | N-Ter-RQIKIWFQNRRMKWKK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | CLL | Leukemia | IC50 : 3.2 ± 0.5 µM |
| dbacp04792 | N-Ter-Antp | N-Ter-RQIKIWFQNRRMKWKK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | MEC-1 | Leukemia | IC50 : 4.2 ± 0.2 µM |
| dbacp04793 | N-Ter-TAT | RDVFTKGYGFGLGRKKRRQRRRPQ | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | SRB assay | A375 | Human endometrial cancer | IC50 : > 50.0 μM |
| dbacp05129 | Pal-N-Ter-TAT | RDVFTKGYGFGLGRKKRRQRRRPQ | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | SRB assay | A375 | Human endometrial cancer | IC50 : 15.2 ± 0.7 μM |
| dbacp05130 | Pal-pFL-N-Ter-TAT | FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | MTT assay | A375 | Leukemia | IC50 : 5.5 ± 1.1 μM |
| dbacp05490 | PFL-N-Ter-TAT | FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ | VDAC1 | Inducing apoptosis | SRB assay | A375 | Human endometrial cancer | IC50 : 5.5 ± 1.1 μM |
| dbacp06301 | Tf-D-LP4 | HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | CLL | Leukemia | IC50 : 1.2 ± 0.1 µM |
| dbacp06302 | Tf-D-LP4 | HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | MEC-1 | Leukemia | IC50 : 1.8 ± 0.2 µM |
| dbacp06303 | Tf-LP4 | HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | CLL | Leukemia | IC50 : 1.7 ± 0.2 µM |
| dbacp06304 | Tf-LP4 | HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | MEC-1 | Leukemia | IC50 : 3.6 ± 0.2 µM |
| dbacp07361 | Pal-N-Ter-TAT | Pal-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ | Analogue of N-terminal fragment of the VDAC1 protein | Mitochondrial targeting, VDAC1-HKII dissociation | MTT assay | A-375 | Skin Cancer | IC50 = 36.67(Supplementary material)/15.2 ± 0.7 μM(Published paper) |
| dbacp07362 | Pal-N-Ter-TAT | Pal-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ | Analogue of N-terminal fragment of the VDAC1 protein | Mitochondrial targeting, VDAC1-HKII dissociation | MTT assay | A-549 | Lung Cancer | IC50 = 44.98 μM |
| dbacp07363 | Pal-N-Ter-TAT | Pal-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ | Analogue of N-terminal fragment of the VDAC1 protein | Mitochondrial targeting, VDAC1-HKII dissociation | MTT assay | MCF-7 | Breast Cancer | IC50 = 27.26 μM |
| dbacp07364 | pFL-N-Ter-TAT | FPWWWPFL-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ | Analogue of N-terminal fragment of the VDAC1 protein | Mitochondrial targeting, VDAC1-HKII dissociation | MTT assay | A-375 | Skin Cancer | IC50 = 11.1 ± 0.1 μM |