dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06131 Smp24 IWSFLIKAATKLLPSLFGGGKKDS Venom, Israeli Gold Scorpion Disrupt the structure and function of cell membranes ATP release assay HepG2 Liver cancer MIC : 32 μg/ml
dbacp06132 Smp43 GVWDWIKKTAGKIWNSEPVKALKSQALNAAKNFVAEKIGATPS Venom, Israeli Gold Scorpion Disrupt the structure and function of cell membranes ATP release assay HepG2 Liver cancer MIC : 512 μg/ml