62 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02315 | Cationic Amphiphilic | GIIKKIIIKKI | AMP | Membrane disruption | WST-1 assay | HeLa | Cervical cancer | IC50 : 160 µM |
| dbacp02316 | Cationic Amphiphilic | GIIKKIIIKKIIIKKI | AMP | Membrane disruption | WST-1 assay | HeLa | Cervical cancer | IC50 : 15 µM |
| dbacp02317 | Cationic Amphiphilic | GIIKKIIIKKIIIKKIIIKKI | AMP | Membrane disruption | WST-1 assay | HeLa | Pancreatic cancer | IC50 : 4 µM |
| dbacp02318 | Cationic Amphiphilic | GIIKKIIIKKI | AMP | Membrane disruption | WST-1 assay | HL-60 | Pancreatic cancer | IC50 : >500 µM |
| dbacp02319 | Cationic Amphiphilic | GIIKKIIIKKIIIKKI | AMP | Membrane disruption | WST-1 assay | HL-60 | Pancreatic cancer | IC50 : 25 µM |
| dbacp02320 | Cationic Amphiphilic | GIIKKIIIKKIIIKKIIIKKI | AMP | Membrane disruption | WST-1 assay | HL-60 | Pancreatic cancer | IC50 : 10 µM |
| dbacp02326 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | WST-1 assay | 486P | Bladder cancer | IC50 : 251.47 µg/ml |
| dbacp02327 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | WST-1 assay | RT4 | Bladder cancer | IC50 : 231.26 µg/ml |
| dbacp02328 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | WST-1 assay | 647V | Bladder cancer | IC50 : 185.39 µg/ml |
| dbacp02329 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | WST-1 assay | J82 | Bladder cancer | IC50 : 212.07 µg/ml |
| dbacp02345 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | WST-1 assay | 486P | Bladder cancer | IC50 : 161.76 µg/ml |
| dbacp02346 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | WST-1 assay | RT4 | Bladder cancer | IC50 : 184.81 µg/ml |
| dbacp02347 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | WST-1 assay | 647V | Bladder cancer | IC50 : 115.12 µg/ml |
| dbacp02348 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | WST-1 assay | J82 | Bladder cancer | IC50 : 97.93 µg/ml |
| dbacp03373 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | BXPC-3 | Pancreatic cancer | IC50 : 6.8 µMol/L |
| dbacp03374 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | SU.86.86 | Pancreatic cancer | IC50 : 7.5 µMol/L |
| dbacp03375 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Bovine lactoferrin (Lf-B) | Induction of apoptosis | WST-1 assay | KB | Oral cancer | IC50 : 13.2 µMol/L |
| dbacp03376 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | T98G | Brain tumor | IC50 : 18.5 µMol/L |
| dbacp03377 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | A-172 | Brain tumor | IC50 : 6.8 µMol/L |
| dbacp03378 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | H-322 | Lung cancer | IC50 : 3.6 µMol/L |
| dbacp03379 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | MDA-MB-231 | Breast cancer | IC50 : 5.7 µMol/L |
| dbacp04347 | Lytic | KLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | BXPC-3 | Pancreatic cancer | IC50 : 37.1 µMol/L |
| dbacp04348 | Lytic | KLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | SU.86.86 | Pancreatic cancer | IC50 : 28.0 µMol/L |
| dbacp04349 | Lytic | KLlLKlLkkLLKlLKKK | Bovine lactoferrin (Lf-B) | Induction of apoptosis | WST-1 assay | KB | Oral cancer | IC50 : 37.4 µMol/L |
| dbacp04350 | Lytic | KLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | T98G | Brain tumor | IC50 : 77.3 µMol/L |
| dbacp04351 | Lytic | KLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | A-172 | Brain tumor | IC50 : 30.5 µMol/L |
| dbacp04352 | Lytic | KLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | H-322 | Lung cancer | IC50 : 27.1 µMol/L |
| dbacp04353 | Lytic | KLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | MDA-MB-231 | Breast cancer | IC50 : 18.5 µMol/L |
| dbacp04354 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | BT-474 | Breast cancer | IC50 : 34.5 µM |
| dbacp04355 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | T-47D | Breast cancer | IC50 : 14.1 µM |
| dbacp04356 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | SK-BR-3 | Breast cancer | IC50 : 25.7 µM |
| dbacp04357 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | MDA-MB-231 | Breast cancer | IC50 : 27.0 µM |
| dbacp04358 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | BT-20 | Breast cancer | IC50 : 20.0 µM |
| dbacp04359 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | ZR75-1 | Breast cancer | IC50 : 19.4 µM |
| dbacp04360 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | SF-295 | Brain tumor | IC50 : 19.1 µM |
| dbacp04361 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | SN-19 | Brain tumor | IC50 : 21.9 µM |
| dbacp04362 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | U-251 | Brain tumor | IC50 : 17.0 µM |
| dbacp04363 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | HuCCT-1 | Human epithelial cancer | IC50 : 17.1 µM |
| dbacp04364 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | LNCaP | Prostate cancer | IC50 : 15.8 µM |
| dbacp04365 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | COLO-587 | Human epithelial cancer | IC50 : 13.5 µM |
| dbacp04476 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane disruption | WST-1 assay | HeLa | Pancreatic cancer | IC50 : > 60 µM |
| dbacp04480 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane perforation | WST-1 assay | RT4(G1) | Bladder cancer | IC50 : 484 µM |
| dbacp04481 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane perforation | WST-1 assay | 647V(G2) | Bladder cancer | IC50 : 52.4 µM |
| dbacp04482 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane perforation | WST-1 assay | 486P(G4) | Bladder cancer | IC50 : 57.8 µM |
| dbacp05094 | P7 | PLLQATLGGGS | Not found | Apoptosis inducing | WST-1 assay | B16-F10 | Skin cancer | IC50 : 1 µM |
| dbacp06329 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | BT-474 | Breast cancer | IC50 : 8.8 µM |
| dbacp06330 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | T-47D | Breast cancer | IC50 : 4.0 µM |
| dbacp06331 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | SK-BR-3 | Breast cancer | IC50 : 6.5 µM |
| dbacp06332 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | MDA-MB-231 | Breast cancer | IC50 : 7.8 µM |
| dbacp06333 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | BT-20 | Breast cancer | IC50 : 4.8 µM |
| dbacp06334 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | ZR75-1 | Breast cancer | IC50 : 9.3 µM |
| dbacp06335 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | SF-295 | Brain tumor | IC50 : 6.3 µM |
| dbacp06336 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | SN-19 | Brain tumor | IC50 : 7.8 µM |
| dbacp06337 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | U-251 | Brain tumor | IC50 :7.0 µM |
| dbacp06338 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | HuCCT-1 | Human epithelial cancer | IC50 : 8.3 µM |
| dbacp06339 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | LNCaP | Prostate cancer | IC50 : 6.2 µM |
| dbacp06340 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | COLO-587 | Human epithelial cancer | IC50 : 6.4 µM |
| dbacp07882 | 0Dap | GIKKWLHSAKKFGKKFVKKIZNS | Synthetic | Not Available | WST-1 assay | PANC-1 | Pancreatic Cancer | EC50 = 9.1±0.3 μM |
| dbacp07883 | 2Dap | GIKXWLHSAKKFGXKFVKKIZNS | Synthetic | Not Available | WST-1 assay | PANC-1 | Pancreatic Cancer | EC50 = 14.7±0.6 μM |
| dbacp07884 | 4Dap | GIKXWLHSAXKFGXKFVKXIZNS | Synthetic | Not Available | WST-1 assay | PANC-1 | Pancreatic Cancer | EC50 = 35.7±0.7 μM |
| dbacp07885 | 6Dap | GIKXWLHSAXXFGXKFVXXIZNS | Synthetic | Not Available | WST-1 assay | PANC-1 | Pancreatic Cancer | EC50 = 55.0±1.8 μM |
| dbacp07886 | 8Dap | GIXXWLHSAXXFGXXFVXXIZNS | Synthetic | Not Available | WST-1 assay | PANC-1 | Pancreatic Cancer | EC50 = 61.4±0.7 μM |