dbACP: A Comprehensive Database of Anti-Cancer Peptides

62 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02315 Cationic Amphiphilic GIIKKIIIKKI AMP Membrane disruption WST-1 assay HeLa Cervical cancer IC50 : 160 µM
dbacp02316 Cationic Amphiphilic GIIKKIIIKKIIIKKI AMP Membrane disruption WST-1 assay HeLa Cervical cancer IC50 : 15 µM
dbacp02317 Cationic Amphiphilic GIIKKIIIKKIIIKKIIIKKI AMP Membrane disruption WST-1 assay HeLa Pancreatic cancer IC50 : 4 µM
dbacp02318 Cationic Amphiphilic GIIKKIIIKKI AMP Membrane disruption WST-1 assay HL-60 Pancreatic cancer IC50 : >500 µM
dbacp02319 Cationic Amphiphilic GIIKKIIIKKIIIKKI AMP Membrane disruption WST-1 assay HL-60 Pancreatic cancer IC50 : 25 µM
dbacp02320 Cationic Amphiphilic GIIKKIIIKKIIIKKIIIKKI AMP Membrane disruption WST-1 assay HL-60 Pancreatic cancer IC50 : 10 µM
dbacp02326 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption WST-1 assay 486P Bladder cancer IC50 : 251.47 µg/ml
dbacp02327 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption WST-1 assay RT4 Bladder cancer IC50 : 231.26 µg/ml
dbacp02328 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption WST-1 assay 647V Bladder cancer IC50 : 185.39 µg/ml
dbacp02329 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption WST-1 assay J82 Bladder cancer IC50 : 212.07 µg/ml
dbacp02345 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption WST-1 assay 486P Bladder cancer IC50 : 161.76 µg/ml
dbacp02346 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption WST-1 assay RT4 Bladder cancer IC50 : 184.81 µg/ml
dbacp02347 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption WST-1 assay 647V Bladder cancer IC50 : 115.12 µg/ml
dbacp02348 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption WST-1 assay J82 Bladder cancer IC50 : 97.93 µg/ml
dbacp03373 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay BXPC-3 Pancreatic cancer IC50 : 6.8 µMol/L
dbacp03374 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay SU.86.86 Pancreatic cancer IC50 : 7.5 µMol/L
dbacp03375 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Bovine lactoferrin (Lf-B) Induction of apoptosis WST-1 assay KB Oral cancer IC50 : 13.2 µMol/L
dbacp03376 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay T98G Brain tumor IC50 : 18.5 µMol/L
dbacp03377 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay A-172 Brain tumor IC50 : 6.8 µMol/L
dbacp03378 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay H-322 Lung cancer IC50 : 3.6 µMol/L
dbacp03379 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay MDA-MB-231 Breast cancer IC50 : 5.7 µMol/L
dbacp04347 Lytic KLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay BXPC-3 Pancreatic cancer IC50 : 37.1 µMol/L
dbacp04348 Lytic KLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay SU.86.86 Pancreatic cancer IC50 : 28.0 µMol/L
dbacp04349 Lytic KLlLKlLkkLLKlLKKK Bovine lactoferrin (Lf-B) Induction of apoptosis WST-1 assay KB Oral cancer IC50 : 37.4 µMol/L
dbacp04350 Lytic KLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay T98G Brain tumor IC50 : 77.3 µMol/L
dbacp04351 Lytic KLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay A-172 Brain tumor IC50 : 30.5 µMol/L
dbacp04352 Lytic KLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay H-322 Lung cancer IC50 : 27.1 µMol/L
dbacp04353 Lytic KLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay MDA-MB-231 Breast cancer IC50 : 18.5 µMol/L
dbacp04354 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay BT-474 Breast cancer IC50 : 34.5 µM
dbacp04355 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay T-47D Breast cancer IC50 : 14.1 µM
dbacp04356 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay SK-BR-3 Breast cancer IC50 : 25.7 µM
dbacp04357 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay MDA-MB-231 Breast cancer IC50 : 27.0 µM
dbacp04358 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay BT-20 Breast cancer IC50 : 20.0 µM
dbacp04359 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay ZR75-1 Breast cancer IC50 : 19.4 µM
dbacp04360 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay SF-295 Brain tumor IC50 : 19.1 µM
dbacp04361 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay SN-19 Brain tumor IC50 : 21.9 µM
dbacp04362 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay U-251 Brain tumor IC50 : 17.0 µM
dbacp04363 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay HuCCT-1 Human epithelial cancer IC50 : 17.1 µM
dbacp04364 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay LNCaP Prostate cancer IC50 : 15.8 µM
dbacp04365 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay COLO-587 Human epithelial cancer IC50 : 13.5 µM
dbacp04476 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane disruption WST-1 assay HeLa Pancreatic cancer IC50 : > 60 µM
dbacp04480 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation WST-1 assay RT4(G1) Bladder cancer IC50 : 484 µM
dbacp04481 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation WST-1 assay 647V(G2) Bladder cancer IC50 : 52.4 µM
dbacp04482 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation WST-1 assay 486P(G4) Bladder cancer IC50 : 57.8 µM
dbacp05094 P7 PLLQATLGGGS Not found Apoptosis inducing WST-1 assay B16-F10 Skin cancer IC50 : 1 µM
dbacp06329 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay BT-474 Breast cancer IC50 : 8.8 µM
dbacp06330 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay T-47D Breast cancer IC50 : 4.0 µM
dbacp06331 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay SK-BR-3 Breast cancer IC50 : 6.5 µM
dbacp06332 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay MDA-MB-231 Breast cancer IC50 : 7.8 µM
dbacp06333 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay BT-20 Breast cancer IC50 : 4.8 µM
dbacp06334 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay ZR75-1 Breast cancer IC50 : 9.3 µM
dbacp06335 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay SF-295 Brain tumor IC50 : 6.3 µM
dbacp06336 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay SN-19 Brain tumor IC50 : 7.8 µM
dbacp06337 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay U-251 Brain tumor IC50 :7.0 µM
dbacp06338 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay HuCCT-1 Human epithelial cancer IC50 : 8.3 µM
dbacp06339 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay LNCaP Prostate cancer IC50 : 6.2 µM
dbacp06340 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay COLO-587 Human epithelial cancer IC50 : 6.4 µM
dbacp07882 0Dap GIKKWLHSAKKFGKKFVKKIZNS Synthetic Not Available WST-1 assay PANC-1 Pancreatic Cancer EC50 = 9.1±0.3 μM
dbacp07883 2Dap GIKXWLHSAKKFGXKFVKKIZNS Synthetic Not Available WST-1 assay PANC-1 Pancreatic Cancer EC50 = 14.7±0.6 μM
dbacp07884 4Dap GIKXWLHSAXKFGXKFVKXIZNS Synthetic Not Available WST-1 assay PANC-1 Pancreatic Cancer EC50 = 35.7±0.7 μM
dbacp07885 6Dap GIKXWLHSAXXFGXKFVXXIZNS Synthetic Not Available WST-1 assay PANC-1 Pancreatic Cancer EC50 = 55.0±1.8 μM
dbacp07886 8Dap GIXXWLHSAXXFGXXFVXXIZNS Synthetic Not Available WST-1 assay PANC-1 Pancreatic Cancer EC50 = 61.4±0.7 μM