7 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02724 | Dermaseptin-PS1 | ALWKTMLKKLGTVALHAGKAALGAVADTISQ | Skin, the waxy monkey tree frog, South America | Penetrating cell membrane | Not specified | Not found | Not found | Not found |
| dbacp02725 | Dermaseptin-PS3 | ALWKDILKNAGKAALNEINQIVQ | Skin, the waxy monkey tree frog, South America | Membrane rupture | MTT assay | H157 | Lung cancer | IC50 : 15.67 μM |
| dbacp02726 | Dermaseptin-PS3 | ALWKDILKNAGKAALNEINQIVQ | Skin, the waxy monkey tree frog, South America | Membrane rupture | MTT assay | PC3 | Human prostate carcinoma | IC50 : 18.20 μM |
| dbacp02727 | Dermaseptin-PS4 | ALWKTLLKHVGKAAGKAALNAVTDMVNQ | Waxy monkey tree frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | MDA-MB-435S | Lung cancer | MIC : 10−9 to 10−4 M |
| dbacp02728 | Dermaseptin-PS4 | ALWKTLLKHVGKAAGKAALNAVTDMVNQ | Waxy monkey tree frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | H157 | Glioma | MIC : 10−9 to 10−4 M |
| dbacp02729 | Dermaseptin-PS4 | ALWKTLLKHVGKAAGKAALNAVTDMVNQ | Waxy monkey tree frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | PC-3 | Prostate cancer | MIC : 10−9 to 10−4 M |
| dbacp02730 | Dermaseptin-PS4 | ALWKTLLKHVGKAAGKAALNAVTDMVNQ | Waxy monkey tree frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | MCF-7 | Breast cancer | MIC : 10−9 to 10−4 M |