dbACP: A Comprehensive Database of Anti-Cancer Peptides

7 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02724 Dermaseptin-PS1 ALWKTMLKKLGTVALHAGKAALGAVADTISQ Skin, the waxy monkey tree frog, South America Penetrating cell membrane Not specified Not found Not found Not found
dbacp02725 Dermaseptin-PS3 ALWKDILKNAGKAALNEINQIVQ Skin, the waxy monkey tree frog, South America Membrane rupture MTT assay H157 Lung cancer IC50 : 15.67 μM
dbacp02726 Dermaseptin-PS3 ALWKDILKNAGKAALNEINQIVQ Skin, the waxy monkey tree frog, South America Membrane rupture MTT assay PC3 Human prostate carcinoma IC50 : 18.20 μM
dbacp02727 Dermaseptin-PS4 ALWKTLLKHVGKAAGKAALNAVTDMVNQ Waxy monkey tree frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay MDA-MB-435S Lung cancer MIC : 10−9 to 10−4 M
dbacp02728 Dermaseptin-PS4 ALWKTLLKHVGKAAGKAALNAVTDMVNQ Waxy monkey tree frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay H157 Glioma MIC : 10−9 to 10−4 M
dbacp02729 Dermaseptin-PS4 ALWKTLLKHVGKAAGKAALNAVTDMVNQ Waxy monkey tree frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay PC-3 Prostate cancer MIC : 10−9 to 10−4 M
dbacp02730 Dermaseptin-PS4 ALWKTLLKHVGKAAGKAALNAVTDMVNQ Waxy monkey tree frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay MCF-7 Breast cancer MIC : 10−9 to 10−4 M