dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02574 Crotamine YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG rattlesnake venom,South American rattlesnake Cell membrane disintegration Not specified Not found Breast cancer Not found
dbacp02576 Crotamine YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG Venom,South American rattlesnake Cell membrane disintegration Not specified Not found Breast cancer Not found