dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05222 Penaeidin-2 YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK Pacific white shrimp Induction of apoptosis MTT assay HK-2 Kidney cancer MIC : 100 μg/mL
dbacp05223 Penaeidin-2 YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK Pacific white shrimp Induction of apoptosis MTT assay ACHN Kidney cancer MIC : 100 μg/mL
dbacp05224 Penaeidin-2 YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK Pacific white shrimp Induction of apoptosis MTT assay A498 Kidney cancer MIC : 100 μg/mL