12 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02821 | DV3-RI-TATp53C’ | LGASWHRPDKGRRRQRRKKRGKKHRSTSQGKKSKLHSSHARSG | Not found | Inducing apoptosis | Not specified | 293T | Not specified | IC50 (Binding for the CXCR4 receptor) <0.01 µMol/L |
| dbacp03380 | Imcroporin | FFSLLPSLIGGLVSAIK | Lesser brown scorpion | Cell membrane disintegration | MTT assay | EK293T | Not found | MIC : 50 µg/ml |
| dbacp05084 | p53C | KKHRSTSQGKKSKLHSSHARSG | Not found | Inducing apoptosis | Not specified | 293T | Not specified | Not found |
| dbacp05950 | RGD-La | RGDLLRHVVKILEKYL | Arg-Gly-Asp(RGD) tripeptide ana temporins | Cell membrane disintegration | MTT/MTS assay | HEK-293T | Renal cancer | 27.86 Inhibition ratio at 50 µg/ml |
| dbacp05959 | RGD-Las | RGDLLRHVVKILSKYL | Arg-Gly-Asp(RGD) tripeptide ana temporins | Cell membrane disintegration | MTT/MTS assay | HEK-293T | Renal cancer | 32.52 Inhibition ratio at 50 µg/ml |
| dbacp06255 | Temporin-La | LLRHVVKILEKYL | Temporins family | Cell membrane disintegration | MTT/MTS assay | HEK-293T | Renal cancer | 30.82 inhibition ratio at 50 µg/ml |
| dbacp06264 | Temporin-Las | LLRHVVKILSKYL | Temporins family | Cell membrane disintegration | MTT/MTS assay | HEK-293T | Renal cancer | 30.90 inhibition ratio at 50 µg/ml |
| dbacp06603 | ZXR-1 | FKIGGFIKKLWRSKLA | Venom base | Inducing apoptosis | MTT assay | 293T | Not found | IC50 : 186.7 ± 13.1 µM |
| dbacp08138 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | MTT assay | HEK-293T | Renal Cancer | 20% cytotoxicity 5 μM concentration |
| dbacp08271 | ZXR-2 | FKIGGFIKKLWRSLLA | Synthetic | Not Available | MTT assay | 293T | Kidney Cancer | IC50 = 6.3 ± 0.7 μM |
| dbacp08342 | VLL-28 | VLLVTLTRLHQRGVIYEKWRHFSGRKYR | Sulfolobus islandicus | Not Available | MTT assay | HEK-293T | Renal Cancer | IC50 = 10 μM |
| dbacp08423 | 5-2C | NYPQRPCRGDKGPDC | Synthetic | Not Available | MTT assay | 293T | Renal Cancer | IC50 = 1.107 μM |