dbACP: A Comprehensive Database of Anti-Cancer Peptides

12 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02821 DV3-RI-TATp53C’ LGASWHRPDKGRRRQRRKKRGKKHRSTSQGKKSKLHSSHARSG Not found Inducing apoptosis Not specified 293T Not specified IC50 (Binding for the CXCR4 receptor) <0.01 µMol/L
dbacp03380 Imcroporin FFSLLPSLIGGLVSAIK Lesser brown scorpion Cell membrane disintegration MTT assay EK293T Not found MIC : 50 µg/ml
dbacp05084 p53C KKHRSTSQGKKSKLHSSHARSG Not found Inducing apoptosis Not specified 293T Not specified Not found
dbacp05950 RGD-La RGDLLRHVVKILEKYL Arg-Gly-Asp(RGD) tripeptide ana temporins Cell membrane disintegration MTT/MTS assay HEK-293T Renal cancer 27.86 Inhibition ratio at 50 µg/ml
dbacp05959 RGD-Las RGDLLRHVVKILSKYL Arg-Gly-Asp(RGD) tripeptide ana temporins Cell membrane disintegration MTT/MTS assay HEK-293T Renal cancer 32.52 Inhibition ratio at 50 µg/ml
dbacp06255 Temporin-La LLRHVVKILEKYL Temporins family Cell membrane disintegration MTT/MTS assay HEK-293T Renal cancer 30.82 inhibition ratio at 50 µg/ml
dbacp06264 Temporin-Las LLRHVVKILSKYL Temporins family Cell membrane disintegration MTT/MTS assay HEK-293T Renal cancer 30.90 inhibition ratio at 50 µg/ml
dbacp06603 ZXR-1 FKIGGFIKKLWRSKLA Venom base Inducing apoptosis MTT assay 293T Not found IC50 : 186.7 ± 13.1 µM
dbacp08138 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing MTT assay HEK-293T Renal Cancer 20% cytotoxicity 5 μM concentration
dbacp08271 ZXR-2 FKIGGFIKKLWRSLLA Synthetic Not Available MTT assay 293T Kidney Cancer IC50 = 6.3 ± 0.7 μM
dbacp08342 VLL-28 VLLVTLTRLHQRGVIYEKWRHFSGRKYR Sulfolobus islandicus Not Available MTT assay HEK-293T Renal Cancer IC50 = 10 μM
dbacp08423 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay 293T Renal Cancer IC50 = 1.107 μM