dbACP: A Comprehensive Database of Anti-Cancer Peptides

4 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp03316 HNP-1 ACYCRIPACIAGERRYGTCIYQGRLWAFCC Human Cell membrane disintegration Not specified Not found Fibrosarcoma Not found
dbacp03329 Human A-defensin-1 (HNP1) ACYCRIPACIAGERRYGTCIYQGRLWAFCC Not found Inducing apoptosis MTT assay A549 Lung cancer Not found
dbacp03330 Human A-defensin-1 (HNP1) ACYCRIPACIAGERRYGTCIYQGRLWAFCC Not found Inducing apoptosis MTT assay COS-7 Lung cancer Not found
dbacp03336 Human neutrophil peptide-1 ACYCRIPACIAGERRYGTCIYQGRLWAFCC Neutrophils; natural killer cells, monocytes; airway, saliva; Human Cell membrane disintegration Not specified Not found Fibrosarcoma Not found