dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01842 BjarLAAO,L-amino-acid oxidase (BjarLAAO-I; LAAO; LAO; Snakes, reptils, animals) ADDKNPLEECFRETDYEEFLEIARNGLKATSNPKRVV Venom base Inducing apoptosis Not specified EAT Gastric cancer Not found
dbacp03542 L-amino-acid oxidase (BjarLAAO-I; LAAO; LAO; Snakes, reptils, animals) ADDKNPLEECFRETDYEEFLEIARNGLKATSNPKRVV Jararaca Not specified Not specified Not found Not found Not found