dbACP: A Comprehensive Database of Anti-Cancer Peptides

10 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp08028 Peptide10 Gonearrestide NDADKDEMQSVYRGKANDDNSRGSKTNHRF Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay HCT-116 Colon Cancer Not Available
dbacp08029 Peptide10 Gonearrestide NDADKDEMQSVYRGKANDDNSRGSKTNHRF Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay DLD-1 Colon Cancer Not Available
dbacp08030 Peptide10 Gonearrestide NDADKDEMQSVYRGKANDDNSRGSKTNHRF Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay HKe-3 Colon Cancer Not Available
dbacp08031 Peptide10 Gonearrestide NDADKDEMQSVYRGKANDDNSRGSKTNHRF Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay Dks8 Colon Cancer Not Available
dbacp08032 Peptide10 Gonearrestide NDADKDEMQSVYRGKANDDNSRGSKTNHRF Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay U-251 Brain tumor Not Available
dbacp08033 Peptide13 Gonearrestide WCYKLPDRVSIKEKGRCN Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay HCT-116 Colon Cancer IC50 ~ 100 μM/L
dbacp08034 Peptide13 Gonearrestide WCYKLPDRVSIKEKGRCN Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay DLD-1 Colon Cancer Not Available
dbacp08035 Peptide13 Gonearrestide WCYKLPDRVSIKEKGRCN Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay HKe-3 Colon Cancer Not Available
dbacp08036 Peptide13 Gonearrestide WCYKLPDRVSIKEKGRCN Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay Dks8 Colon Cancer Not Available
dbacp08037 Peptide13 Gonearrestide WCYKLPDRVSIKEKGRCN Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay U-251 Brain tumor Not Available