dbACP: A Comprehensive Database of Anti-Cancer Peptides

8 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp07006 ST101 vaeareelerlearlgqargelkkwkmrrnqfwlklqr Synthetic Prevents C/EBPβ dimerization, induces degradation Annexin V/ PI staining assay U-251 Brain Tumor mean EC50 value of 2.1 ± 0.4 μmol/L
dbacp07007 ST101 vaeareelerlearlgqargelkkwkmrrnqfwlklqr Synthetic Prevents C/EBPβ dimerization, induces degradation Annexin V/ PI staining assay MCF-7 Breast Cancer mean EC50 value of 2.1 ± 0.4 μmol/L
dbacp07008 ST101 vaeareelerlearlgqargelkkwkmrrnqfwlklqr Synthetic Prevents C/EBPβ dimerization, induces degradation Annexin V/ PI staining assay A-375 Skin Cancer mean EC50 value of 2.1 ± 0.4 μmol/L
dbacp07009 ST101 vaeareelerlearlgqargelkkwkmrrnqfwlklqr Synthetic Prevents C/EBPβ dimerization, induces degradation Annexin V/ PI staining assay DU-145 Prostate Cancer mean EC50 value of 2.1 ± 0.4 μmol/L
dbacp07010 ST101 vaeareelerlearlgqargelkkwkmrrnqfwlklqr Synthetic Prevents C/EBPβ dimerization, induces degradation Annexin V/ PI staining assay A-549 Lung Cancer mean EC50 value of 2.1 ± 0.4 μmol/L
dbacp07011 ST101 vaeareelerlearlgqargelkkwkmrrnqfwlklqr Synthetic Prevents C/EBPβ dimerization, induces degradation Annexin V/ PI staining assay T98G Brain Tumor mean EC50 value of 2.1 ± 0.4 μmol/L
dbacp08430 hBD3-3 M1 GKCSTRGRKCMRRKK Synthetic Not Available Annexin V/ PI staining assay MDA-MB-231 Breast Cancer Inhibition in growth by apoptosis as cells positive for annexin V formed 50% of test group
dbacp08432 hBD3-3 M2 GKCSTRGRKMCRRKK Synthetic Not Available Annexin V/ PI staining assay MDA-MB-231 Breast Cancer Inhibition in growth by apoptosis as cells positive for annexin V formed 50% of test group