8 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp07006 | ST101 | vaeareelerlearlgqargelkkwkmrrnqfwlklqr | Synthetic | Prevents C/EBPβ dimerization, induces degradation | Annexin V/ PI staining assay | U-251 | Brain Tumor | mean EC50 value of 2.1 ± 0.4 μmol/L |
| dbacp07007 | ST101 | vaeareelerlearlgqargelkkwkmrrnqfwlklqr | Synthetic | Prevents C/EBPβ dimerization, induces degradation | Annexin V/ PI staining assay | MCF-7 | Breast Cancer | mean EC50 value of 2.1 ± 0.4 μmol/L |
| dbacp07008 | ST101 | vaeareelerlearlgqargelkkwkmrrnqfwlklqr | Synthetic | Prevents C/EBPβ dimerization, induces degradation | Annexin V/ PI staining assay | A-375 | Skin Cancer | mean EC50 value of 2.1 ± 0.4 μmol/L |
| dbacp07009 | ST101 | vaeareelerlearlgqargelkkwkmrrnqfwlklqr | Synthetic | Prevents C/EBPβ dimerization, induces degradation | Annexin V/ PI staining assay | DU-145 | Prostate Cancer | mean EC50 value of 2.1 ± 0.4 μmol/L |
| dbacp07010 | ST101 | vaeareelerlearlgqargelkkwkmrrnqfwlklqr | Synthetic | Prevents C/EBPβ dimerization, induces degradation | Annexin V/ PI staining assay | A-549 | Lung Cancer | mean EC50 value of 2.1 ± 0.4 μmol/L |
| dbacp07011 | ST101 | vaeareelerlearlgqargelkkwkmrrnqfwlklqr | Synthetic | Prevents C/EBPβ dimerization, induces degradation | Annexin V/ PI staining assay | T98G | Brain Tumor | mean EC50 value of 2.1 ± 0.4 μmol/L |
| dbacp08430 | hBD3-3 M1 | GKCSTRGRKCMRRKK | Synthetic | Not Available | Annexin V/ PI staining assay | MDA-MB-231 | Breast Cancer | Inhibition in growth by apoptosis as cells positive for annexin V formed 50% of test group |
| dbacp08432 | hBD3-3 M2 | GKCSTRGRKMCRRKK | Synthetic | Not Available | Annexin V/ PI staining assay | MDA-MB-231 | Breast Cancer | Inhibition in growth by apoptosis as cells positive for annexin V formed 50% of test group |