13 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00308 | (ATAP) Amphipathic tail-anchoring peptide of Bfl-1 | KFEPKSGWMTFLEVTGKICEMLSLLKQYC | Anti apoptotic (MCL-1, BFL1) | Apoptosis inducing | Not specified | HeLa | Not found | Not found |
| dbacp01193 | ATAP-iRGD peptide-Parental | KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 1.6 μM |
| dbacp01194 | ATAP-iRGD-M1 | AFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 36 μM |
| dbacp01195 | ATAP-iRGD-M2 | LFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 68 μM |
| dbacp01196 | ATAP-iRGD-M3 | KFEPLSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 25 μM |
| dbacp01197 | ATAP-iRGD-M5 | KFEPKSGWETFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 6 μM |
| dbacp01198 | ATAP-iRGD-M6 | KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 3.1 μM |
| dbacp01199 | ATAP-iRGD-M7 | KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 2.1 μM |
| dbacp01200 | ATAP-iRGD-M8 | KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 2.1 μM |
| dbacp04629 | MCL-1, BH3 (208-228) | KALETLRRVGDGVQRNHETAF | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | Not specified | Not found | Blood cancer | Not found |
| dbacp04630 | MCL-1, BH3 (208-228) | KALETLRRVGDGVQRNHETAF | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | Not specified | Not found | Leukemia | Not found |
| dbacp04631 | MCL-1, BH3 (208-228) | KALETLRRVGDGVQRNHETAF | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | Not specified | Not found | Skin cancer | Not found |
| dbacp04632 | MCL-1, BH3 (208-228) | KALETLRRVGDGVQRNHETAF | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | Not specified | Not found | Breast cancer | Not found |