dbACP: A Comprehensive Database of Anti-Cancer Peptides

9 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06771 Moricin AKIPIKAAIKTVGKAVGKGLRAINIASTANDVFNFLKPKKRKA Bombyx mori Peptide-induced cell death MTT assay MDA-MB-231 Triple-negative Breast Cancer 70% cell viability at 6.25 µg/ml
dbacp06772 Moricin AKIPIKAAIKTVGKAVGKGLRAINIASTANDVFNFLKPKKRKA Bombyx mori Peptide-induced cell death LDH release assay MDA-MB-231 Triple-negative Breast Cancer Significant decrease in cell viability at 6.25 μg/ml
dbacp06773 Moricin AKIPIKAAIKTVGKAVGKGLRAINIASTANDVFNFLKPKKRKA Bombyx mori Peptide-induced cell death Trypan blue assay MDA-MB-231 Triple-negative Breast Cancer 70% cell viability at 6.25 µg/ml
dbacp07931 myristoyl-CM4 GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI Bombyx mori Cell penetration, Mitochondrial dysfunction, Apoptosis pathway activation MTT assay MCF-7 Breast cancer IC50 = 6 μM
dbacp07932 myristoyl-CM4 GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI Bombyx mori Enhanced binding, mitochondrial dysfunction, apoptosis MTT assay MDA-MB-231 Breast cancer IC50 = 4 μM
dbacp07933 myristoyl-CM4 GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI Bombyx mori Enhanced binding, mitochondrial dysfunction, apoptosis MTT assay MX-1 Breast cancer IC50 = 3 μM
dbacp08167 Bmattacin2 Not Available silkworm Bombyx mori Not Available MTS assay A-375 Skin Cancer IC50 = 5.23 μM
dbacp08168 Bmattacin2 Not Available silkworm Bombyx mori Not Available MTS assay HCT-116 Colorectal Cancer IC50 = 1.70 μM
dbacp08253 Cecropin XJ APEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK Larvae of Bombyx mori CecropinXJ induces apoptosis in HCC MTT assay Huh-7 Liver Cancer Cell viability = 50% at 50 µmol/l