dbACP: A Comprehensive Database of Anti-Cancer Peptides

1 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp04633 mCRAMP GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ Bone marrow, saliva, Mice Direct pore formation leading to leakage of intracellular components and cell death Not specified Not found Not found Not found