165 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00004 | Citropin modified peptide-3 | GLFAVIKKVASVIGGL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 6 M |
| dbacp00013 | Citropin modified peptide-5 | GLFDVIKAVASVIGGL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 5 M |
| dbacp00022 | Citropin modified peptide-7 | GLFDVIKKVAAVIGGL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 5 M |
| dbacp00101 | Citropin modified peptide-11 | GLFDVIKKVASVIKGL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 5 M |
| dbacp00110 | Citropin modified peptide-13 | GLFDVIKKVASVIKKL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 5 M |
| dbacp00119 | Citropin modified peptide-14 | GLFDVIAKVASVIKKL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 5 M |
| dbacp00153 | Citropin modified peptide-15 | GLFAVIKKVASVIKGL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 5 M |
| dbacp00186 | Citropin modified peptide-16 | GLFAVIKKVASVIKKL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 5 M |
| dbacp00220 | Citropin modified peptide-17 | GLFAVIKKVAAVIKKL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 5 M |
| dbacp00255 | Citropin modified peptide-18 | GLFAVIKKVAAVIRRL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 5 M |
| dbacp00264 | Citropin modified peptide-19 | GLFAVIKKVAKVIKKL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 5 M |
| dbacp00273 | Citropin modified peptide-22 | GLFKVIKKVASVIGGL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 5 M |
| dbacp00295 | Citropin modified peptide-23 | GLFKVIKKVAKVIKKL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 5 M |
| dbacp00816 | AAD (or Aa-Pri1) | MDSNKDERAYAQWVIIILHNVGSSPFKIANLGLSWGKLYADGNKDKEVYPSDYNGKTVGPDEKIQINSCGRENASSGTEGSFDIVDPNDGNKTIRHFYWECPWGSKRNTWTPSGSNTKWMVEWSGQNLDSGALGTITVDVLRKGN | Purified from chestnut mushroom | Apoptosis inducing | MTT/MTS assay | SH-SY5Y | Brain tumor | At 2.5 µM concentration,decrease in cell vibility: 70% |
| dbacp01255 | Aurein 3.1 | GLFDIVKKIAGHIAGSI | Southern bell frog, Australia | Cell membrane disruption | Not specified | Brain tumor cell line | Brain tumor | LC50 : 10-100 µM |
| dbacp01264 | Aurein 3.1 | GLFDIVKKIAGHIAGSI | Southern bell frog, Australia | Cell membrane disruption | Not specified | Brain tumor cell line | Brain tumor | LC50 : 10-100 µM |
| dbacp01274 | Aurein 3.2 | GLFDIVKKIAGHIASSI | Southern bell frog, Australia | Cell membrane disruption | Not specified | Brain tumor cell line | Brain tumor | LC50 : 10 µM |
| dbacp01284 | Aurein 3.3 | GLFDIVKKIAGHIVSSI | Southern bell frog, Australia | Cell membrane disruption | Not specified | Brain tumor cell line | Brain tumor | LC50 : 10 µM |
| dbacp01409 | Aurein1.2 | GLFDIIKKIAESF | Southern bell frog | Cell membrane disruption | Not specified | Brain tumor cell line | Brain tumor | LC50 : 10 µM |
| dbacp01418 | Aurein2.5 | GLFDIVKKVVGAFGSL | Southern bell frog | Cell membrane disruption | Not specified | Brain tumor cell line | Brain tumor | LC50 : 10 µM |
| dbacp01427 | Aurein2.6 | GLFDIAKKVIGVIGSL | Southern bell frog | Cell membrane disruption | Not specified | Brain tumor cell line | Brain tumor | LC50 : 10 µM |
| dbacp02012 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | SF-268 | Brain tumor | IC50 : 12.4 µg/ml |
| dbacp02013 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | SF-295 | Brain tumor | IC50 : 12.9 µg/ml |
| dbacp02014 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | SF-539 | Brain tumor | IC50 : 9.5 µg/ml |
| dbacp02015 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | SNB-19 | Brain tumor | IC50 : 13.8 µg/ml |
| dbacp02016 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | SNB-75 | Brain tumor | IC50 : 15.5 µg/ml |
| dbacp02017 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | U-251 | Brain tumor | IC50 : 10.6 µg/ml |
| dbacp02491 | Citropin 1.1 | GLFDVIKKVASVIGGL | Amphibian skin secretions | Penetration and disruption of the membranes | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 5 M |
| dbacp02502 | Citropin 1.1D | glfdvikkvasviggl | Amphibian skin secretions | Penetration and disruption of the membranes | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 5 M |
| dbacp02693 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Brain tumor | IC50 : 7.44 μM |
| dbacp02698 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Brain tumor | IC50 : 49.51 μM |
| dbacp02703 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Brain tumor | IC50 : 25.51 μM |
| dbacp02708 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Brain tumor | IC50 : 21.78 μM |
| dbacp02713 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Brain tumor | IC50 : 28.95 μM |
| dbacp02718 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Brain tumor | IC50 : 51.04 μM |
| dbacp03376 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | T98G | Brain tumor | IC50 : 18.5 µMol/L |
| dbacp03377 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | A-172 | Brain tumor | IC50 : 6.8 µMol/L |
| dbacp03485 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Brain tumor | IC50 : 8.64μM |
| dbacp03490 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Brain tumor | IC50 : 18.51μM |
| dbacp03495 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Brain tumor | IC50 : 9.88μM |
| dbacp03500 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Brain tumor | IC50 : 9.97μM |
| dbacp03505 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Brain tumor | IC50 : 11.17μM |
| dbacp03510 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Brain tumor | IC50 : 48.80μM |
| dbacp03638 | Lactoferricin B | FKCRRWQWRMKKLGA | Temporins family | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | Kelly | Brain tumor | IC50 : 15.5 µM |
| dbacp03639 | Lactoferricin B | FKCRRWQWRMKKLGA | Temporins family | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | IMR-32 | Brain tumor | IC50 : 29 µM |
| dbacp03640 | Lactoferricin B | FKCRRWQWRMKKLGA | Temporins family | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | SK-N-DZ | Brain tumor | IC50 : 37 µM |
| dbacp03641 | Lactoferricin B | FKCRRWQWRMKKLGA | Temporins family | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | SHEP-12 | Brain tumor | IC50 : 45 µM |
| dbacp03642 | Lactoferricin B | FKCRRWQWRMKKLGA | Temporins family | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | SH-SY-5Y2 | Brain tumor | IC50 : 60 µM |
| dbacp03732 | LfcinB | FKCRRWQWRMKK | Bovine lactoferrin (Lf-B) | Cell membrane disintegration; Regulation of immune response; Apoptosis | MTT/MTS assay | Kelly | Brain tumor | IC50 : 141 ± 3 µM |
| dbacp04298 | LTX-302 | WKKW-Dip-KKWK | Synthetic peptide | Cell membrane disintegration | MTT/MTS assay | Kelly | Brain tumor | IC50 : 28 ± 0 µM |
| dbacp04301 | LTX-315 | KKWWKKW-Dip-K | Synthetic peptide | Cell membrane disintegration | MTT/MTS assay | Kelly | Brain tumor | IC50 : 14 ± 1 µM |
| dbacp04307 | LTX-318 | OOW-Dip-OOWWO | Synthetic peptide | Cell membrane disintegration | MTT/MTS assay | Kelly | Brain tumor | IC50 : 78 ± 7 µM |
| dbacp04350 | Lytic | KLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | T98G | Brain tumor | IC50 : 77.3 µMol/L |
| dbacp04351 | Lytic | KLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | A-172 | Brain tumor | IC50 : 30.5 µMol/L |
| dbacp04360 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | SF-295 | Brain tumor | IC50 : 19.1 µM |
| dbacp04361 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | SN-19 | Brain tumor | IC50 : 21.9 µM |
| dbacp04362 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | U-251 | Brain tumor | IC50 : 17.0 µM |
| dbacp04865 | NK-2 | KILRGVCKKIMRTFLRRISKDILTGKK | NK-lysin | Cell membrane disintegration | PI-uptake assay | SH-SY5Y | Brain tumor | LD50 : 1-4 µM |
| dbacp05825 | R8-BadBH3 | rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | SK-N-AS | Brain tumor | 0% apoptosis at 10 µM |
| dbacp05826 | R8-BadBH3 | rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | SK-N-AS | Brain tumor | 10% apoptosis at 20 µM |
| dbacp05827 | R8-BadBH3 | rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | SK-N-AS | Brain tumor | 30% apoptosis at 50 µM |
| dbacp05828 | R8-BadBH3 | rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | NB69 | Brain tumor | 30% apoptosis at 10 µM |
| dbacp05829 | R8-BadBH3 | rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | NB69 | Brain tumor | 80% apoptosis at 20 µM |
| dbacp05830 | R8-BadBH3 | rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | NB69 | Brain tumor | 80% apoptosis at 50 µM |
| dbacp05839 | R8-BidBH3 | rrrrrrrrGEDIIRNIARHLAQVGDSMDR | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | SK-N-AS | Brain tumor | 8% apoptosis at 10 µM |
| dbacp05840 | R8-BidBH3 | rrrrrrrrGEDIIRNIARHLAQVGDSMDR | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | SK-N-AS | Brain tumor | 45% apoptosis at 20 µM |
| dbacp05841 | R8-BidBH3 | rrrrrrrrGEDIIRNIARHLAQVGDSMDR | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | SK-N-AS | Brain tumor | 65% apoptosis at 50 µM |
| dbacp05842 | R8-BidBH3 | rrrrrrrrGEDIIRNIARHLAQVGDSMDR | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | NB69 | Brain tumor | 25% apoptosis at 10 µM |
| dbacp05843 | R8-BidBH3 | rrrrrrrrGEDIIRNIARHLAQVGDSMDR | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | NB69 | Brain tumor | 66% apoptosis at 20 µM |
| dbacp05844 | R8-BidBH3 | rrrrrrrrGEDIIRNIARHLAQVGDSMDR | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | NB69 | Brain tumor | 68% apoptosis at 50 µM |
| dbacp05851 | R8-BidBH3Alt | rrrrrrrrGEDIIRNIARHAAQVGASMDR | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | SK-N-AS | Brain tumor | 1% apoptosis at 10 µM |
| dbacp05852 | R8-BidBH3Alt | rrrrrrrrGEDIIRNIARHAAQVGASMDR | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | SK-N-AS | Brain tumor | 2% apoptosis at 20 µM |
| dbacp05853 | R8-BidBH3Alt | rrrrrrrrGEDIIRNIARHAAQVGASMDR | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | SK-N-AS | Brain tumor | 3% apoptosis at 50 µM |
| dbacp05854 | R8-BidBH3Alt | rrrrrrrrGEDIIRNIARHAAQVGASMDR | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | NB69 | Brain tumor | 2% apoptosis at 10 µM |
| dbacp05855 | R8-BidBH3Alt | rrrrrrrrGEDIIRNIARHAAQVGASMDR | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | NB69 | Brain tumor | 1% apoptosis at 20 µM |
| dbacp05856 | R8-BidBH3Alt | rrrrrrrrGEDIIRNIARHAAQVGASMDR | Synthetic Peptide | Inducing mitochondrial apoptosis | MTT/MTS assay | NB69 | Brain tumor | 5% apoptosis at 50 µM |
| dbacp05937 | Retro | LGGIVSAVKKIVDFLG | Amphibian skin secretions | Penetration and disruption of the membranes | Sulforhodamine B assay | Brain tumor cell line | Brain tumor | IC50 : 5 M |
| dbacp06335 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | SF-295 | Brain tumor | IC50 : 6.3 µM |
| dbacp06336 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | SN-19 | Brain tumor | IC50 : 7.8 µM |
| dbacp06337 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | U-251 | Brain tumor | IC50 :7.0 µM |
| dbacp06364 | TsAP-2 | FLGMIPGLIGGLISAFK | Venom-derived cDNAlibrary of the Brazilian yellow scorpion | Not specified | MTT/MTS assay | U251-MG | Brain tumor | IC50 : 15.4 µM |
| dbacp06372 | TsAP-S1 | FLSLIPKLVKKIIKAFK | Derivative of TsAP-1, Brazilian yellow scorpion venom peptide | Not specified | MTT/MTS assay | U251-MG | Brain tumor | IC50 : 2.9 µM |
| dbacp06380 | TsAP-S2 | FLGMIPKLIKKLIKAFK | Derivative of TsAP-1, Brazilian yellow scorpion venom peptide | Not specified | MTT/MTS assay | U251-MG | Brain tumor | IC50 : 2.0 µM |
| dbacp06576 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | Daudi | Brain tumor | IC50 : 115 µg/ml |
| dbacp06671 | Crabrolin | FLPLILRKIVTAL | European hornet (Vespa crabro) | Not available | MTT assay | U-251-MG | Brain Tumor | IC50 = 20.13 μM |
| dbacp06676 | Crabrolin-4R | FLPRILRKIVTAL | Synthetic Analog of Crabrolin | Not available | MTT assay | U-251-MG | Brain Tumor | IC50 = 25.09 μM |
| dbacp06681 | Crabrolin-4K | FLPKILRKIVTAL | Synthetic Analog of Crabrolin | Not available | MTT assay | U-251-MG | Brain Tumor | IC50 = 23.51 μM |
| dbacp06686 | Crabrolin-TR | FLPRILRKIVRAL | Synthetic Analog of Crabrolin | Not available | MTT assay | U-251-MG | Brain Tumor | IC50 = 12.40 μM |
| dbacp06691 | Crabrolin-FR | RLPRILRKIVRAL | Synthetic Analog of Crabrolin | Not available | MTT assay | U-251-MG | Brain Tumor | IC50 = 62.17 μM |
| dbacp06696 | Crabrolin-AR | RLPRILRKIVRRL | Synthetic Analog of Crabrolin | Not available | MTT assay | U-251-MG | Brain Tumor | IC50 = 52.01 μM |
| dbacp06701 | Crabrolin-PR | RLRRILRKIVRRL | Synthetic Analog of Crabrolin | Not available | MTT assay | U-251-MG | Brain Tumor | IC50 = 17.70 μM |
| dbacp06750 | mPNC-NLS | QETFSDLWKLLVQRKRQKLMP | Synthetic | p53-mediated apoptosis | MTT assay | U-87 | Brain Tumor | IC50 = 56.9 μM |
| dbacp07006 | ST101 | vaeareelerlearlgqargelkkwkmrrnqfwlklqr | Synthetic | Prevents C/EBPβ dimerization, induces degradation | Annexin V/ PI staining assay | U-251 | Brain Tumor | mean EC50 value of 2.1 ± 0.4 μmol/L |
| dbacp07011 | ST101 | vaeareelerlearlgqargelkkwkmrrnqfwlklqr | Synthetic | Prevents C/EBPβ dimerization, induces degradation | Annexin V/ PI staining assay | T98G | Brain Tumor | mean EC50 value of 2.1 ± 0.4 μmol/L |
| dbacp07050 | Temporin-PKE | FLPLIIGALSSLLPKIF | skin secretion of Pelophylax kl. esculentus | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 23.24 μM |
| dbacp07055 | Temporin-PKE-2K | FLPLIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 2.49 μM |
| dbacp07060 | Temporin-PKE-K12 | FLPLIIGALSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 25.75 μM |
| dbacp07065 | Temporin-PKE-3K | FLPKIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 2.83 μM |
| dbacp07070 | Temporin-PKE-4K | FLPKIIGKLSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 85.52 μM |
| dbacp07075 | Temporin-PKE-i | FLPLIIGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 4.46 μM |
| dbacp07080 | Temporin-PKE-3i | FLPLiiGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 120.6 μM |
| dbacp07109 | Nigrocin-M1 | GLLGKILGAGKKVLLGVSGLL | Synthetic | Membrane disruption mediates selective cytotoxicity. | MTT assay | U-251-MG | Brain Tumor | IC50 = 25.06 μM |
| dbacp07241 | RB4 | MADSERLSAPGCWAACTNFSRTRK | Derived from protein PLP2 | F-actin modulation induces necrotic death. | MTT assay | U-87 | Brain Tumor | EC50 = 0.427 ± 0.053 mol/L × 10-3 |
| dbacp07246 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | U87-MG | Brain Tumor | IC50 = 4.3 ± 0.3 μM |
| dbacp07247 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | U-251 | Brain Tumor | IC50 = 4.9 ± 0.3 μM |
| dbacp07248 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | A-172 | Brain Tumor | IC50 = 6.4 ± 0.4 μM |
| dbacp07249 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | T98G | Brain Tumor | IC50 = 7.1 ± 0.2 μM |
| dbacp07250 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | U-373 | Brain Tumor | IC50 = 5.0 ± 0.2 μM |
| dbacp07251 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | U-118 | Brain Tumor | IC50 = 6.8 ± 0.2 μM |
| dbacp07252 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | D54 | Brain Tumor | IC50 = 8.4 ± 0.1 μM |
| dbacp07253 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | SW-1783 | Brain Tumor | IC50 = 4.8 ± 0.2 μM |
| dbacp07254 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | LN229 | Brain Tumor | IC50 = 4.7 ± 0.2 μM |
| dbacp07255 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | U-138 | Brain Tumor | IC50 = 7.5 ± 0.3 μM |
| dbacp07256 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | SF-268 | Brain Tumor | IC50 = 4.8 ± 0.1 μM |
| dbacp07257 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | SNB-19 | Brain Tumor | IC50 = 12.0 ± 0.6 μM |
| dbacp07262 | t-DPH1-K4 | GLWKKIKNVAAAAGKAALGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | U251-MG | Brain Tumor | IC50 = 32.18 μM |
| dbacp07266 | t-DPH1-5K | GLWKKIKNVAKAAGKAALGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | U251-MG | Brain Tumor | IC50 = 2.679 μM |
| dbacp07270 | t-DPH1-6K | GLWKKIKNVAKAAGKAAKGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | U251-MG | Brain Tumor | IC50 = 593.7 μM |
| dbacp07274 | t-DPH1-6KW | WLWKKIKNVAKAAGKAAKGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | U251-MG | Brain Tumor | IC50 = 1499 μM |
| dbacp07314 | B1OS-L | FLPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | U251-MG | Brain Tumor | IC50 = 8.629 µM |
| dbacp07319 | B1OS-D-L | FlPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | U251-MG | Brain Tumor | IC50 = 3.492 µM |
| dbacp07408 | Dermaseptin-TO | ALWKDLLKNVGIAAGKAALNKVTDMVNQ | Phyllomedusa tomopterna | Membrane disruption induces cell death | MTT assay | U251-MG | Brain Tumor | Graph Figure-7 |
| dbacp07439 | A4K14 - Citropin 1.1 - Sp 7 | GLFAVR8KKVASVS5KGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | U-87 | Brain Tumor | IC50 = 14.72 µM |
| dbacp07443 | A4K14 - Citropin 1.1 - Sp 6 | GR8FAVIKKS5ASVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | U-87 | Brain Tumor | IC50 = 34.49 µM |
| dbacp07447 | A4K14 - Citropin 1.1 - Sp 5 | GLFAVIKKVAS5VIKS5L | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | U-87 | Brain Tumor | IC50 = 8.229 µM |
| dbacp07451 | A4K14 - Citropin 1.1 - Sp 4 | GLFAVIKKS5ASVS5KGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | U-87 | Brain Tumor | IC50 = 7.277 µM |
| dbacp07455 | A4K14 - Citropin 1.1 - Sp 3 | GLFAVS5KKVS5SVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | U-87 | Brain Tumor | IC50 = 11.93 µM |
| dbacp07459 | A4K14 - Citropin 1.1 - Sp 2 | GLFAS5IKKS5ASVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | U-87 | Brain Tumor | IC50 = 14.76 µM |
| dbacp07463 | A4K14 - Citropin 1.1 - Sp 1 | GS5FAVS5KKVASVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | U-87 | Brain Tumor | IC50 = 11.88 µM |
| dbacp07494 | RA-3 | RWrGGGGGLFDIIKKIAESF | Synthetic | Integrin-targeting, α-helix mediated lysis | MTT assay | U87-MG | Brain Tumor | IC50 = 32.27 μM |
| dbacp07515 | Dermaseptin-PP | ALWKDMLKGIGKLAGKAALGAVKTLV | Phyllomedusa palliata | Membrane disruption triggers dual apoptosis | MTT assay | U-251 | Brain Tumor | IC50 = 2.47 μM |
| dbacp07649 | AP1-Z1 | FLFSLIPHAISGLISAFK | AcrAP1 from the venom of the Arabian scorpion | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | IC50 = 10.21 μM |
| dbacp07652 | AP1-Z5a | FLFKLIPKAIKGLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | Graph Figure 2C |
| dbacp07655 | AP1-Z5b | FLFKLIKHAIKGLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | IC50 = 3.115 μM |
| dbacp07658 | AP1-Z3a | FLFSLIKHAIKGLISAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | Graph Figure 2C |
| dbacp07661 | AP1-Z3b | FLFSLIKHAISKLISAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | Graph Figure 2C |
| dbacp07664 | AP1-Z7 | FLFKLIKKAIKKLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | Graph Figure 2C |
| dbacp07667 | AP1-Z9 | FLFKLIKKKIKKLIKKFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | Graph Figure 2C |
| dbacp07850 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Phyllomedusa tarsius | Membrane disruption and cationic enhancement | MTT assay | U251-MG | Brain Tumor | IC50 = 49.51 µM |
| dbacp07855 | K8, 23-DPT9 | GLWSKIKKAAKTAGKAALGFVNKMV | Synthetic | Membrane disruption and cationic enhancement | MTT assay | U251-MG | Brain Tumor | IC50 = 18.51 µM |
| dbacp07934 | LyeTx-I-b | IWLTALKFLGKNLGKLAKQQLAKL | Synthetic | Membrane disruption, necroptosis, limited apoptosis | MTT/Resazurin dye assay | U-87-MG | Brain Tumor | IC50 = 29.20 ± 7.96 µM |
| dbacp07935 | LyeTx-I-b | IWLTALKFLGKNLGKLAKQQLAKL | Synthetic | Membrane disruption, necroptosis, limited apoptosis | MTT/Resazurin dye assay | U-373-MG | Brain Tumor | IC50 = 20.94 ± 5.18 µM |
| dbacp07936 | LyeTx-I-b | IWLTALKFLGKNLGKLAKQQLAKL | Synthetic | Membrane disruption, necroptosis, limited apoptosis | MTT/Resazurin dye assay | SH-SY5Y | Brain Tumor | IC50 = 93.80 ± 2.17 µM |
| dbacp07954 | S-24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Synthetic Analogue of Ranatuerin-2PLx | R2PLx induces caspase-dependent apoptosis | MTT assay | U-251-MG | Brain Tumor | IC50 = 278.30 µM |
| dbacp08022 | Peptide4 Gonearrestide | ADAPGNYPLDARGKSYYC | Androctonus australis | Gonearrestide induces G1 cell-cycle arrest | MTT assay | U-251 | Brain tumor | Not Available |
| dbacp08027 | Peptide6 Gonearrestide | KLSAIISKIRDE | Androctonus australis | Gonearrestide induces G1 cell-cycle arrest | MTT assay | U-251 | Brain tumor | Not Available |
| dbacp08032 | Peptide10 Gonearrestide | NDADKDEMQSVYRGKANDDNSRGSKTNHRF | Androctonus mauritanicus | Gonearrestide induces G1 cell-cycle arrest | MTT assay | U-251 | Brain tumor | Not Available |
| dbacp08037 | Peptide13 Gonearrestide | WCYKLPDRVSIKEKGRCN | Androctonus mauritanicus | Gonearrestide induces G1 cell-cycle arrest | MTT assay | U-251 | Brain tumor | Not Available |
| dbacp08044 | Silk Fibroin peptide | Not Available | Silkworm Cocoons | SFP induces S-phase cell-cycle arrest | MTT assay | LN229 | Brain Tumor | IC50 = 13.32 ± 1.15 mg/ml |
| dbacp08065 | Temporin-PE | FLPIVAKLLSGLL | Pelophylax kl. esculentus | Modulates membrane interactions | MTT assay | U251-MG | Brain Tumor | IC50 = 25.13 μM |
| dbacp08069 | temporin-PEa | FLYIVAKLLSGLL | Synthetic analog of Temporin-PE | Modulates membrane interactions | MTT assay | U251-MG | Brain Tumor | IC50 = 3.520 μM |
| dbacp08073 | temporin-PEb | FLPIVAKLLSGLLGRKKRRQRRR | Synthetic analog of Temporin-PE | Modulates membrane interactions | MTT assay | U251-MG | Brain Tumor | IC50 = 3.087 μM |
| dbacp08078 | APETx4 | GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD | Anthopleura elegantissima | Not Available | CellTox Green Dye assay | SH-SY5Y | Brain Tumor | Green object count = 400 /mm2 at 20 μM |
| dbacp08272 | [Lys5,6] TG | UGLUKKLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 7 µM |
| dbacp08274 | [Lys6] TG | UGLUGKLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 4 µM |
| dbacp08276 | Trichogin GA | UGLUGGLUGI | Trichoderma longibrachiatum | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 2 µM |
| dbacp08278 | [TOAC1] TG | XGLUGGLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 1 µM |
| dbacp08280 | [TOAC1, Lys6] TG | XGLUGKLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 1 µM |
| dbacp08282 | [Arg2] TG | URLUGGLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 8 µM |
| dbacp08284 | [TOAC1, Arg2] TG | XRLUGGLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 8 µM |
| dbacp08286 | [TOAC1, Arg9] TG | XGLUGGLURI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 8 µM |
| dbacp08288 | [TOAC1, Lys5,6] TG | XGLUKKLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 10 µM |
| dbacp08290 | [TOAC1, Api4] TG | XGLZGGLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 13 µM |
| dbacp08294 | CA4 | CGPCFTTDHNMARKCDECCGGKGRGKCFGPQCLCR | Synthetic | Not Available | MTT assay | U-251 | Brain Tumor | Graph Figure 2 |
| dbacp08295 | CTX-23 | VCMPCFTTDQQMARKCSDCCGGKGRGKCYGPQCLCR | Synthetic | Not Available | MTT assay | U-251 | Brain Tumor | Graph Figure 2 |