dbACP: A Comprehensive Database of Anti-Cancer Peptides

16 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02515 Cliotide T1 GIPCGESCVFIPCITGAIGCSCKSKVCYRN Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02516 Cliotide T1 GIPCGESCVFIPCITGAIGCSCKSKVCYRN Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02517 Cliotide T1 (cT1; Plant defensin) GIPCGESCVFIPCITAAIGCSCKSKVCYRN Butterfly pea Not specified MTT assay HeLa cells Not found IC50 : 0.6 µM
dbacp02518 Cliotide T10 GVPCAESCVWIPCTVTALLGCSCKDKVCYLN Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02519 Cliotide T12 GIPCGESCVYIPCTVTALLGCSCKDKVCYKN Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02520 Cliotide T19 GSVIKCGESCLLGKCYTPGCTCSRPICKKD Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02521 Cliotide T2 GEFLKCGESCVQGECYTPGCSCDWPICKKN Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02522 Cliotide T2 GEFLKCGESCVQGECYTPGCSCDWPICKKN Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02523 Cliotide T2 (cT2; Plant defensin) GEFLKCGESCVQGECYTPGCSCDWPICKKN Butterfly pea Not specified MTT assay HeLa cells Not found IC50 : 8.0 µM
dbacp02524 Cliotide T3 GLPTCGETCTLGTCYVPDCSCSWPICMKN Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02525 Cliotide T3 GLPTCGETCTLGTCYVPDCSCSWPICMKN Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02526 Cliotide T3 (cT3; Plant defensin) GLPTCGETCTLGTCYVPDCSCSWPICMKN Butterfly pea Not specified MTT assay HeLa cells Not found IC50 : 2.0 µM
dbacp02527 Cliotide T4 GIPCGESCVFIPCITAAIGCSCKSKVCYRN Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02528 Cliotide T4 GIPCGESCVFIPCITAAIGCSCKSKVCYRN Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02529 Cliotide T4 (cT4; Plant defensin) GIPCGESCVFIPCITGAIGCSCKSKVCYRN Butterfly pea Not specified MTT assay HeLa cells Not found IC50 : 0.6 µM
dbacp02530 Cliotide T7 GIPCGESCVFIPCTVTALLGCSCKDKVCYKN Butterfly pea Not specified Not specified Not found Not found Not found