dbACP: A Comprehensive Database of Anti-Cancer Peptides

7 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06063 Shepherdin KHSSGCAFL Not found Inducing apoptosis MTT assay HeLa Cervical carcinoma IC50 : 25–75 µM
dbacp06067 Shepherdin (ATP) RQIKIWFQNRRMKWKKKHSSGCAFL Not found Inducing apoptosis MTT assay HeLa Cervical carcinoma IC50 : 50–75 μM
dbacp06071 Shepherdin (TAT) YGRKKRRQRRRKHSSGCAFL Not found Inducing apoptosis MTT assay HeLa Cervical carcinoma IC50 : 50–75 μM
dbacp06144 Ss-arasin MERTLLIVLLVCFLLLAVTAEA The Indian mud crab Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets MTT assay HeLa Human cervical carcinoma IC 50 : 3.06 μM
dbacp06146 Ss-arasin SPRVRRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG The Indian mud crab Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets MTT assay HT-29 Human cervical carcinoma IC 50 : 2.90 μM
dbacp06243 Temporin-1RNa ILPIRSLIKKLL The black-spotted frog, Northeastern China, Asia Disruption of membrane Cytotoxicity assay, MTT/MTS assay HeLa Cervical carcinoma IC50 : 24.5 ± 3.8 µM
dbacp06245 Temporin-1RNb FLPLKKLRFGLL The black-spotted frog, Northeastern China, Asia Disruption of membrane Cytotoxicity assay, MTT/MTS assay HeLa Cervical carcinoma IC50 : 12.8 ± 8.6 µM