7 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp06063 | Shepherdin | KHSSGCAFL | Not found | Inducing apoptosis | MTT assay | HeLa | Cervical carcinoma | IC50 : 25–75 µM |
| dbacp06067 | Shepherdin (ATP) | RQIKIWFQNRRMKWKKKHSSGCAFL | Not found | Inducing apoptosis | MTT assay | HeLa | Cervical carcinoma | IC50 : 50–75 μM |
| dbacp06071 | Shepherdin (TAT) | YGRKKRRQRRRKHSSGCAFL | Not found | Inducing apoptosis | MTT assay | HeLa | Cervical carcinoma | IC50 : 50–75 μM |
| dbacp06144 | Ss-arasin | MERTLLIVLLVCFLLLAVTAEA | The Indian mud crab | Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets | MTT assay | HeLa | Human cervical carcinoma | IC 50 : 3.06 μM |
| dbacp06146 | Ss-arasin | SPRVRRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG | The Indian mud crab | Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets | MTT assay | HT-29 | Human cervical carcinoma | IC 50 : 2.90 μM |
| dbacp06243 | Temporin-1RNa | ILPIRSLIKKLL | The black-spotted frog, Northeastern China, Asia | Disruption of membrane | Cytotoxicity assay, MTT/MTS assay | HeLa | Cervical carcinoma | IC50 : 24.5 ± 3.8 µM |
| dbacp06245 | Temporin-1RNb | FLPLKKLRFGLL | The black-spotted frog, Northeastern China, Asia | Disruption of membrane | Cytotoxicity assay, MTT/MTS assay | HeLa | Cervical carcinoma | IC50 : 12.8 ± 8.6 µM |