dbACP: A Comprehensive Database of Anti-Cancer Peptides

23 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp04702 Mram 8 GIPCGESCVFIPCLTSAIDCSCKSKVCYRN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp04703 Mram 8 GIPCGESCVFIPCLTSAIDCSCKSKVCYRN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp04704 Mram 8 GIPCGESCVFIPCLTSAIDCSCKSKVCYRN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06488 Viba 15 GLPVCGETCVGGTCNTPGCACSWPVCTRN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06489 Viba 15 GLPVCGETCVGGTCNTPGCACSWPVCTRN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06490 Viba 15 GLPVCGETCVGGTCNTPGCACSWPVCTRN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06491 Viba17 GLPVCGETCVGGTCNTPGCGCSWPVCTRN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06492 Viba17 GLPVCGETCVGGTCNTPGCGCSWPVCTRN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06493 Viba17 GLPVCGETCVGGTCNTPGCGCSWPVCTRN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06502 Viphi A GSIPCGESCVFIPCISSVIGCACKSKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06503 Viphi A GSIPCGESCVFIPCISSVIGCACKSKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06504 Viphi D GIPCGESCVFIPCISSVIGCSCSSKVCYRN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06505 Viphi D GIPCGESCVFIPCISSVIGCSCSSKVCYRN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06506 Viphi E GSIPCGESCVFIPCISAVIGCSCSNKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06507 Viphi E GSIPCGESCVFIPCISAVIGCSCSNKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06508 Viphi E GSIPCGESCVFIPCISAVIGCSCSNKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06509 Viphi F GSIPCGESCVFIPCISSVIGCACKSKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06510 Viphi F GSIPCGESCVFIPCISAIIGCSCSSKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06511 Viphi F GSIPCGESCVFIPCISAIIGCSCSSKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06512 Viphi F GSIPCGESCVFIPCISAIIGCSCSSKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06513 Viphi G GSIPCEGSCVFIPCISAIIGCSCSNKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06514 Viphi G GSIPCEGSCVFIPCISAIIGCSCSNKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06515 Viphi G GSIPCEGSCVFIPCISAIIGCSCSNKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found