dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp03281 hBD-1 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK Keratinocytes; skin; platelets; Human Cell membrane disintegration Not specified Not found Fibrosarcoma Not found
dbacp03282 hBD-1 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK Airway, hemofiltrates, urine, kidney; keratinocytes; skin; platelets; oral saliva; milk, mammary gland epithelium, colonic mucosa, Human Cell membrane disintegration Not specified Not found Fibrosarcoma Not found