13 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02472 | Chickpea peptide | ADLPGLK | Plant sources | Inducing apoptosis | SRB assay | A-549 | Human endometrial cancer | IC50 : 126.4 ± 1.98 µM |
| dbacp02473 | Chickpea peptide | ADLPGLK | Plant sources | Inducing apoptosis | SRB assay | HepG-2 | Human endometrial cancer | IC50 : 113.7 ± 0.99 µM |
| dbacp02474 | Chickpea peptide | ADLPGLK | Plant sources | Inducing apoptosis | SRB assay | Ishikawa | Human endometrial cancer | IC50 : 101.5 ± 1.83 µM |
| dbacp02475 | Chickpea peptide | ADLPGLK | Plant sources | Inducing apoptosis | SRB assay | MCF-7 | Human endometrial cancer | IC50 : 110.3 ± 2.97µM |
| dbacp02476 | Chickpea peptide | ADLPGLK | Plant sources | Inducing apoptosis | SRB assay | MDA-MB-231 | Human endometrial cancer | IIC50 : 107.2 ± 1.62µM |
| dbacp02477 | Chickpea peptide | ADLPGLK | Plant sources | Inducing apoptosis | SRB assay | PA-1 | Human endometrial cancer | IC50 : 133.4 ± 0.70µM |
| dbacp03649 | Lan-7 | fA*YwKA*T | Analogue of TT-232 | Tubulin depolymerization | Sulforhodamine B assay | HEC-59 | Endometrial cancer | IC50 : 36.81 ± 0.40 µM |
| dbacp04693 | MIPP | SLSLSVAR | Plant sources | Inducing apoptosis | SRB assay | HeLa | Human endometrial cancer | Not found |
| dbacp04790 | N-Ter | RDVFTKGYGFGL | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | SRB assay | A375 | Human endometrial cancer | IC50 : > 50.0 μM |
| dbacp04793 | N-Ter-TAT | RDVFTKGYGFGLGRKKRRQRRRPQ | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | SRB assay | A375 | Human endometrial cancer | IC50 : > 50.0 μM |
| dbacp05129 | Pal-N-Ter-TAT | RDVFTKGYGFGLGRKKRRQRRRPQ | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | SRB assay | A375 | Human endometrial cancer | IC50 : 15.2 ± 0.7 μM |
| dbacp05490 | PFL-N-Ter-TAT | FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ | VDAC1 | Inducing apoptosis | SRB assay | A375 | Human endometrial cancer | IC50 : 5.5 ± 1.1 μM |
| dbacp06919 | Q7 | EQQQQQQPQNRRFRE | Pisum sativum | Inhibition of cell signalling | MTT assay | HEC-1-A | Endometrial Cancer | IC50 = 129.82 ± 7.53 μM |