dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06504 Viphi D GIPCGESCVFIPCISSVIGCSCSSKVCYRN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06505 Viphi D GIPCGESCVFIPCISSVIGCSCSSKVCYRN Chinese Violet herb Not specified Not specified Not found Not found Not found