dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp07931 myristoyl-CM4 GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI Bombyx mori Cell penetration, Mitochondrial dysfunction, Apoptosis pathway activation MTT assay MCF-7 Breast cancer IC50 = 6 μM
dbacp07932 myristoyl-CM4 GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI Bombyx mori Enhanced binding, mitochondrial dysfunction, apoptosis MTT assay MDA-MB-231 Breast cancer IC50 = 4 μM
dbacp07933 myristoyl-CM4 GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI Bombyx mori Enhanced binding, mitochondrial dysfunction, apoptosis MTT assay MX-1 Breast cancer IC50 = 3 μM