dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05703 Psyle E GVIPCGESCVFIPCISSVLGCSCKNKVCYRD **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi Necrosis; Cell membrane rupture Not specified Not found Not found Not found
dbacp05704 Psyle E GVIPCGESCVFIPCISSVLGCSCKNKVCYRD **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi Necrosis; Cell membrane rupture Not specified Not found Not found Not found
dbacp05705 Psyle E GVIPCGESCVFIPCISSVLGCSCKNKVCYRD **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi Necrosis; Cell membrane rupture Not specified Not found Not found Not found