5 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02338 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | MTT/MTS assay | SCC12 | Skin cancer | IC50 : 1 µM |
| dbacp02339 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | MTT/MTS assay | SCC25 | Skin cancer | IC50 : 2.2 µM |
| dbacp02340 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | Cell viability assay | SCC25 | Skin cancer | 0.6 ± 0.6% cell growth inhibition at 10 µM |
| dbacp02341 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | Cell viability assay | SCC25 | Skin cancer | 107.0 ± 5.0% cell growth inhibition at 1 µM |
| dbacp02343 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Giant silk moth, cecropia moth | Cell membrane disintegration | Not specified | Not found | Not found | Not found |