dbACP: A Comprehensive Database of Anti-Cancer Peptides

6 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05104 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05108 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05112 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05116 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05120 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05124 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM