7 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp05950 | RGD-La | RGDLLRHVVKILEKYL | Arg-Gly-Asp(RGD) tripeptide ana temporins | Cell membrane disintegration | MTT/MTS assay | HEK-293T | Renal cancer | 27.86 Inhibition ratio at 50 µg/ml |
| dbacp05959 | RGD-Las | RGDLLRHVVKILSKYL | Arg-Gly-Asp(RGD) tripeptide ana temporins | Cell membrane disintegration | MTT/MTS assay | HEK-293T | Renal cancer | 32.52 Inhibition ratio at 50 µg/ml |
| dbacp06255 | Temporin-La | LLRHVVKILEKYL | Temporins family | Cell membrane disintegration | MTT/MTS assay | HEK-293T | Renal cancer | 30.82 inhibition ratio at 50 µg/ml |
| dbacp06264 | Temporin-Las | LLRHVVKILSKYL | Temporins family | Cell membrane disintegration | MTT/MTS assay | HEK-293T | Renal cancer | 30.90 inhibition ratio at 50 µg/ml |
| dbacp06328 | Transactivator of transcript-DV1-Bcl-2, AT-DV1-BH3 | RRRQRRKKRGGGGLGASWHRPDK | Transactivator of transcript-DV1-Bcl-2 TAT-DV1-BH5 | Apoptosis inducing | Cell viability assay, Transwell invasion assay | HEK-293 | Kidney cancer | Not specified |
| dbacp08138 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | MTT assay | HEK-293T | Renal Cancer | 20% cytotoxicity 5 μM concentration |
| dbacp08342 | VLL-28 | VLLVTLTRLHQRGVIYEKWRHFSGRKYR | Sulfolobus islandicus | Not Available | MTT assay | HEK-293T | Renal Cancer | IC50 = 10 μM |