dbACP: A Comprehensive Database of Anti-Cancer Peptides

6 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05950 RGD-La RGDLLRHVVKILEKYL Arg-Gly-Asp(RGD) tripeptide ana temporins Cell membrane disintegration MTT/MTS assay HEK-293T Renal cancer 27.86 Inhibition ratio at 50 µg/ml
dbacp05959 RGD-Las RGDLLRHVVKILSKYL Arg-Gly-Asp(RGD) tripeptide ana temporins Cell membrane disintegration MTT/MTS assay HEK-293T Renal cancer 32.52 Inhibition ratio at 50 µg/ml
dbacp06255 Temporin-La LLRHVVKILEKYL Temporins family Cell membrane disintegration MTT/MTS assay HEK-293T Renal cancer 30.82 inhibition ratio at 50 µg/ml
dbacp06264 Temporin-Las LLRHVVKILSKYL Temporins family Cell membrane disintegration MTT/MTS assay HEK-293T Renal cancer 30.90 inhibition ratio at 50 µg/ml
dbacp08138 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing MTT assay HEK-293T Renal Cancer 20% cytotoxicity 5 μM concentration
dbacp08342 VLL-28 VLLVTLTRLHQRGVIYEKWRHFSGRKYR Sulfolobus islandicus Not Available MTT assay HEK-293T Renal Cancer IC50 = 10 μM