3 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02359 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | HRT-18 | Colon cancer | IC50 : 25.5 µM |
| dbacp02373 | Cecropin P1 | SWLSKTAKKLENSAKKRISEGIAIAIQGGPR | Small Intestine of Pig | Pore formation at the cytoplasmic membrane | MTT/MTS assay | HRT-18 | Colon cancer | IC50 : >100 µM |
| dbacp06077 | Shiva-1 | MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG | African clawed frog | Pore formation at the cytoplasmic membrane | MTT/MTS assay | HRT-18 | Colon cancer | IC50 : 49.3 µM |