dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02359 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay HRT-18 Colon cancer IC50 : 25.5 µM
dbacp02373 Cecropin P1 SWLSKTAKKLENSAKKRISEGIAIAIQGGPR Small Intestine of Pig Pore formation at the cytoplasmic membrane MTT/MTS assay HRT-18 Colon cancer IC50 : >100 µM
dbacp06077 Shiva-1 MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG African clawed frog Pore formation at the cytoplasmic membrane MTT/MTS assay HRT-18 Colon cancer IC50 : 49.3 µM