2 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp06144 | Ss-arasin | MERTLLIVLLVCFLLLAVTAEA | The Indian mud crab | Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets | MTT assay | HeLa | Human cervical carcinoma | IC 50 : 3.06 μM |
| dbacp06146 | Ss-arasin | SPRVRRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG | The Indian mud crab | Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets | MTT assay | HT-29 | Human cervical carcinoma | IC 50 : 2.90 μM |