dbACP: A Comprehensive Database of Anti-Cancer Peptides

11 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02472 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay A-549 Human endometrial cancer IC50 : 126.4 ± 1.98 µM
dbacp02473 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay HepG-2 Human endometrial cancer IC50 : 113.7 ± 0.99 µM
dbacp02474 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay Ishikawa Human endometrial cancer IC50 : 101.5 ± 1.83 µM
dbacp02475 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay MCF-7 Human endometrial cancer IC50 : 110.3 ± 2.97µM
dbacp02476 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay MDA-MB-231 Human endometrial cancer IIC50 : 107.2 ± 1.62µM
dbacp02477 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay PA-1 Human endometrial cancer IC50 : 133.4 ± 0.70µM
dbacp04693 MIPP SLSLSVAR Plant sources Inducing apoptosis SRB assay HeLa Human endometrial cancer Not found
dbacp04790 N-Ter RDVFTKGYGFGL VDAC1(voltage-dependent anion channel1) Inducing apoptosis SRB assay A375 Human endometrial cancer IC50 : > 50.0 μM
dbacp04793 N-Ter-TAT RDVFTKGYGFGLGRKKRRQRRRPQ VDAC1(voltage-dependent anion channel1) Inducing apoptosis SRB assay A375 Human endometrial cancer IC50 : > 50.0 μM
dbacp05129 Pal-N-Ter-TAT RDVFTKGYGFGLGRKKRRQRRRPQ VDAC1(voltage-dependent anion channel1) Inducing apoptosis SRB assay A375 Human endometrial cancer IC50 : 15.2 ± 0.7 μM
dbacp05490 PFL-N-Ter-TAT FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ VDAC1 Inducing apoptosis SRB assay A375 Human endometrial cancer IC50 : 5.5 ± 1.1 μM