21 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00719 | 3A | LTAEHYAAQATS | Not found | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : >100 µM |
| dbacp00992 | Akt-in | AVTDHPDRLWAWEKF | Not found | Inducing apoptosis | Co-immunoprecipitation, GST Pull-down,GST Competition, In Vitro Akt Kinase, PKA Kinase, In Vitro PDK1 Kinase, PtdIns(3,4,5)P3 Lipid-Protein Pull-down, Proliferation assay, Cell Death assay and Mitochondrial Permeability Transition assay | T4 | T-cell Leukemia | Not found |
| dbacp02746 | DI | LTFEHYWAQLTS | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 0.29 µM |
| dbacp02747 | DI | LTFEHYWAQLTS | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 1.6 µM |
| dbacp02786 | DN-C16orf74 | RRRRRRRRRRR-GGG-KHLDVPVIVIPPTPT | Not found | Cell membrane penetration | Immunoprecipitation assay | PDAC cells | Pancreatic ductal adenocarcinoma | Not found |
| dbacp03387 | Interferon gamma (IFN-gamma) | MNYTSYILAFQLCVILCSSGYYCQAMFFKEIENLKEYFNASNPDVADGGPLFLDILKNWREESDKTIIQSQIVSFYLKLFENFKDNQIIQRSMDTIKEDMLFKFFNSSTSKRSDFLKLIQIPVNDMQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK | Giant panda | Regulation of immune response | Whole-blood IFN-gamma assay,Real-time reverse transcription–polymerase chain reaction (RT-PCR) assay | HEK293 | Renal cancer | No activity |
| dbacp04685 | MIP | PRFWEYWLRLME | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 0.01 µM |
| dbacp04686 | MIP | PRFWEYWLRLME | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 0.12 µM |
| dbacp04687 | MIP(F3A) | PRAWEYWLRLME | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 0.57 µM |
| dbacp04688 | MIP(L10A) | PRFWEYWLRAME | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 1.14 µM |
| dbacp04689 | MIP(M11A) | PRFWEYWLRLAE | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 0.4 µM |
| dbacp04690 | MIP(R9A) | PRFWEYWLALME | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 0.02 µM |
| dbacp04691 | MIP(W7A) | PRFWEYALRLME | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : >100 µM |
| dbacp04692 | MIP(Y6A) | PRFWEAWLRLME | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : >100 µM |
| dbacp05082 | P5317-28 | QETFSDLWKLLP | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 4.7 µM |
| dbacp05083 | P5317-28 | QETFSDLWKLLP | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 30 µM |
| dbacp05569 | Piscidin-4 | FIHHIIGGLFSAGKAIHRLIRRRRR | Nile tilapia | Necrosis | Adenosine triphosphate (ATP) assay | A549 | Non-small cell Lung cancer (NSCLC) | IC50 : 1.922 – 27.62 µM |
| dbacp05570 | Piscidin-4 | FIHHIIGGLFSAGKAIHRLIRRRRR | Nile tilapia | Necrosis | Adenosine triphosphate (ATP) assay | NCI-H661 | Non-small cell Lung cancer (NSCLC) | IC50 : 3.769 – 14.17 µM |
| dbacp05571 | Piscidin-4 | FIHHIIGGLFSAGKAIHRLIRRRRR | Nile tilapia | Necrosis | Adenosine triphosphate (ATP) assay | NCI-H1975 | Non-small cell Lung cancer (NSCLC) | IC50 : 1.241 – 5.472 µM |
| dbacp05572 | Piscidin-4 | FIHHIIGGLFSAGKAIHRLIRRRRR | Nile tilapia | Necrosis | Adenosine triphosphate (ATP) assay | HCC827 | Non-small cell Lung cancer (NSCLC) | IC50 :10.61 – 18.52 µM |
| dbacp07984 | SOR-C13 | KEFLHPSKVDLPR | Synthetic | TRPV6 inhibition suppresses ovarian tumors | IP | SKOV-3 | Ovarian Cancer | Effectively inhibited the growth of tumor |