dbACP: A Comprehensive Database of Anti-Cancer Peptides

21 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00719 3A LTAEHYAAQATS Not found Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : >100 µM
dbacp00992 Akt-in AVTDHPDRLWAWEKF Not found Inducing apoptosis Co-immunoprecipitation, GST Pull-down,GST Competition, In Vitro Akt Kinase, PKA Kinase, In Vitro PDK1 Kinase, PtdIns(3,4,5)P3 Lipid-Protein Pull-down, Proliferation assay, Cell Death assay and Mitochondrial Permeability Transition assay T4 T-cell Leukemia Not found
dbacp02746 DI LTFEHYWAQLTS E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 0.29 µM
dbacp02747 DI LTFEHYWAQLTS E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 1.6 µM
dbacp02786 DN-C16orf74 RRRRRRRRRRR-GGG-KHLDVPVIVIPPTPT Not found Cell membrane penetration Immunoprecipitation assay PDAC cells Pancreatic ductal adenocarcinoma Not found
dbacp03387 Interferon gamma (IFN-gamma) MNYTSYILAFQLCVILCSSGYYCQAMFFKEIENLKEYFNASNPDVADGGPLFLDILKNWREESDKTIIQSQIVSFYLKLFENFKDNQIIQRSMDTIKEDMLFKFFNSSTSKRSDFLKLIQIPVNDMQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK Giant panda Regulation of immune response Whole-blood IFN-gamma assay,Real-time reverse transcription–polymerase chain reaction (RT-PCR) assay HEK293 Renal cancer No activity
dbacp04685 MIP PRFWEYWLRLME E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 0.01 µM
dbacp04686 MIP PRFWEYWLRLME E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 0.12 µM
dbacp04687 MIP(F3A) PRAWEYWLRLME E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 0.57 µM
dbacp04688 MIP(L10A) PRFWEYWLRAME E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 1.14 µM
dbacp04689 MIP(M11A) PRFWEYWLRLAE E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 0.4 µM
dbacp04690 MIP(R9A) PRFWEYWLALME E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 0.02 µM
dbacp04691 MIP(W7A) PRFWEYALRLME E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : >100 µM
dbacp04692 MIP(Y6A) PRFWEAWLRLME E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : >100 µM
dbacp05082 P5317-28 QETFSDLWKLLP E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 4.7 µM
dbacp05083 P5317-28 QETFSDLWKLLP E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 30 µM
dbacp05569 Piscidin-4 FIHHIIGGLFSAGKAIHRLIRRRRR Nile tilapia Necrosis Adenosine triphosphate (ATP) assay A549 Non-small cell Lung cancer (NSCLC) IC50 : 1.922 – 27.62 µM
dbacp05570 Piscidin-4 FIHHIIGGLFSAGKAIHRLIRRRRR Nile tilapia Necrosis Adenosine triphosphate (ATP) assay NCI-H661 Non-small cell Lung cancer (NSCLC) IC50 : 3.769 – 14.17 µM
dbacp05571 Piscidin-4 FIHHIIGGLFSAGKAIHRLIRRRRR Nile tilapia Necrosis Adenosine triphosphate (ATP) assay NCI-H1975 Non-small cell Lung cancer (NSCLC) IC50 : 1.241 – 5.472 µM
dbacp05572 Piscidin-4 FIHHIIGGLFSAGKAIHRLIRRRRR Nile tilapia Necrosis Adenosine triphosphate (ATP) assay HCC827 Non-small cell Lung cancer (NSCLC) IC50 :10.61 – 18.52 µM
dbacp07984 SOR-C13 KEFLHPSKVDLPR Synthetic TRPV6 inhibition suppresses ovarian tumors IP SKOV-3 Ovarian Cancer Effectively inhibited the growth of tumor