4 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp04592 | Mauriporin | MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR | Fat-tailed scorpion | Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis | MTT assay, Lactate dehydrogenase (LDH) Release assay | Hela | Human cervical cancer | IC50 : 27.9 μM - 283.3 μM |
| dbacp04593 | Mauriporin | MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR | Fat-tailed scorpion | Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis | MTT assay, Lactate dehydrogenase (LDH) Release assay | SACC-83 | Human salivary adenoid cystic carcinoma | IC50 : 27.9 μM - 283.3 μM |
| dbacp04594 | Mauriporin | MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR | Fat-tailed scorpion | Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis | MTT assay, Lactate dehydrogenase (LDH) Release assay | HepG2 | Human liver cancer | IC50 : 27.9 μM - 283.3 μM |
| dbacp04595 | Mauriporin | MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR | Fat-tailed scorpion | Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis | MTT assay, Lactate dehydrogenase (LDH) Release assay | PC-3 | Human Prostate cancer | IC50 : 27.9 μM - 283.3 μM |