dbACP: A Comprehensive Database of Anti-Cancer Peptides

4 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp04592 Mauriporin MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR Fat-tailed scorpion Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis MTT assay, Lactate dehydrogenase (LDH) Release assay Hela Human cervical cancer IC50 : 27.9 μM - 283.3 μM
dbacp04593 Mauriporin MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR Fat-tailed scorpion Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis MTT assay, Lactate dehydrogenase (LDH) Release assay SACC-83 Human salivary adenoid cystic carcinoma IC50 : 27.9 μM - 283.3 μM
dbacp04594 Mauriporin MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR Fat-tailed scorpion Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis MTT assay, Lactate dehydrogenase (LDH) Release assay HepG2 Human liver cancer IC50 : 27.9 μM - 283.3 μM
dbacp04595 Mauriporin MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR Fat-tailed scorpion Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis MTT assay, Lactate dehydrogenase (LDH) Release assay PC-3 Human Prostate cancer IC50 : 27.9 μM - 283.3 μM