dbACP: A Comprehensive Database of Anti-Cancer Peptides

144 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02843 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 45% Cytotoxicity at 50 mg/L
dbacp02844 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 38% Cytotoxicity at 25 mg/L
dbacp02845 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 75% Cytotoxicity at 50 mg/L
dbacp02846 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 65% Cytotoxicity at 25 mg/L
dbacp02847 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 75 % Cytotoxicity at 50 mg/L
dbacp02848 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 65% Cytotoxicity at 25 mg/L
dbacp02849 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 83% Cytotoxicity at 50 mg/L
dbacp02850 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 77 % Cytotoxicity at 25 mg/L
dbacp02851 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 82 % Cytotoxicity at 50 mg/L
dbacp02852 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp02853 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 42 % Cytotoxicity at 12.5 mg/L
dbacp02854 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 41 % Cytotoxicity at 6.25 mg/L
dbacp02855 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 39 % Cytotoxicity at 3.125 mg/L
dbacp02856 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp02857 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 95 % Cytotoxicity at 25 mg/L
dbacp02858 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 45 % Cytotoxicity at 12.5 mg/L
dbacp02859 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 25 % Cytotoxicity at 6.25 mg/L
dbacp02860 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 25 % Cytotoxicity at 3.125 mg/L
dbacp02861 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 95 % Cytotoxicity at 50 mg/L
dbacp02862 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 96 % Cytotoxicity at 25 mg/L
dbacp02863 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 46 % Cytotoxicity at 12.5 mg/L
dbacp02864 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp02865 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 28 % Cytotoxicity at 3.125 mg/L
dbacp02866 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 84 % Cytotoxicity at 50 mg/L
dbacp02867 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp02868 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 38 % Cytotoxicity at 12.5 mg/L
dbacp02869 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp02870 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 28 % Cytotoxicity at 3.125 mg/L
dbacp02874 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 60 % Cytotoxicity at 50 mg/L
dbacp02875 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 50 % Cytotoxicity at 25 mg/L
dbacp02876 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 8 % Cytotoxicity at 12.5 mg/L
dbacp02877 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 10 % Cytotoxicity at 6.25 mg/L
dbacp02878 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 5 % Cytotoxicity at 3.125 mg/L
dbacp02879 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 75 % Cytotoxicity at 50 mg/L
dbacp02880 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 70 % Cytotoxicity at 25 mg/L
dbacp02881 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 5 % Cytotoxicity at 12.5 mg/L
dbacp02882 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 7 % Cytotoxicity at 6.25 mg/L
dbacp02883 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 10 % Cytotoxicity at 3.125 mg/L
dbacp02884 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 76 % Cytotoxicity at 50 mg/L
dbacp02885 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 70 % Cytotoxicity at 25 mg/L
dbacp02886 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 12 % Cytotoxicity at 12.5 mg/L
dbacp02887 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 6.25 mg/L
dbacp02888 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 3.125 mg/L
dbacp02889 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 90 % Cytotoxicity at 50 mg/L
dbacp02890 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 75 % Cytotoxicity at 25 mg/L
dbacp02891 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 8 % Cytotoxicity at 12.5 mg/L
dbacp02892 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 3 % Cytotoxicity at 6.25 mg/L
dbacp02893 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 3 % Cytotoxicity at 3.125 mg/L
dbacp02894 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 60 % Cytotoxicity at 50 mg/L
dbacp02895 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 50 % Cytotoxicity at 25 mg/L
dbacp02896 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 8 % Cytotoxicity at 12.5 mg/L
dbacp02897 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 6.25 mg/L
dbacp02898 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 5 % Cytotoxicity at 3.125 mg/L
dbacp02899 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 75 % Cytotoxicity at 50 mg/L
dbacp02900 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 70 % Cytotoxicity at 25 mg/L
dbacp02901 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 5 %Cytotoxicity at 12.5 mg/L
dbacp02902 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 7 % Cytotoxicity at 6.25 mg/L
dbacp02903 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 3.125 mg/L
dbacp02904 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 76 % Cytotoxicity at 50 mg/L
dbacp02905 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 70 % Cytotoxicity at 25 mg/L
dbacp02906 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 12 % Cytotoxicity at 12.5 mg/L
dbacp02907 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 4 % Cytotoxicity at 6.25 mg/L
dbacp02908 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 4 % Cytotoxicity at 3.125 mg/L
dbacp02909 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp02910 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 75 % Cytotoxicity at 25 mg/L
dbacp02911 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 8 % Cytotoxicity at 12.5 mg/L
dbacp02912 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 3 % Cytotoxicity at 6.25 mg/L
dbacp02913 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 3 % Cytotoxicity at 3.125 mg/L
dbacp05139 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 62 % Cytotoxicity at 50 mg/L
dbacp05140 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 44 % Cytotoxicity at 25 mg/L
dbacp05141 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 12.5 mg/L
dbacp05142 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 75 % Cytotoxicity at 50 mg/L
dbacp05143 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 70 % Cytotoxicity at 25 mg/L
dbacp05144 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 3.125 mg/L
dbacp05145 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 78 % Cytotoxicity at 50 mg/L
dbacp05146 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 68 % Cytotoxicity at 25 mg/L
dbacp05147 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 12.5 mg/L
dbacp05148 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 5 % Cytotoxicity at 6.25 mg/L
dbacp05149 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 10 % Cytotoxicity at 3.125 mg/L
dbacp05150 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 90 % Cytotoxicity at 50 mg/L
dbacp05151 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 80 % Cytotoxicity at 25 mg/L
dbacp05152 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 15 % Cytotoxicity at 12.5 mg/L
dbacp05153 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 12 % Cytotoxicity at 6.25 mg/L
dbacp05154 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 5 % Cytotoxicity at 3.125 mg/L
dbacp05155 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 88 % Cytotoxicity at 50 mg/L
dbacp05156 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 82 % Cytotoxicity at 25 mg/L
dbacp05157 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 40 % Cytotoxicity at 12.5 mg/L
dbacp05158 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 6.25 mg/L
dbacp05159 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 3.125 mg/L
dbacp05160 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05161 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 25 mg/L
dbacp05162 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 12.5 mg/L
dbacp05163 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp05164 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 3.125 mg/L
dbacp05165 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 97 % Cytotoxicity at 50 mg/L
dbacp05166 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 95 % Cytotoxicity at 25 mg/L
dbacp05167 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 39 % Cytotoxicity at 12.5 mg/L
dbacp05168 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 28 % Cytotoxicity at 6.25 mg/L
dbacp05169 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 38 % Cytotoxicity at 3.125 mg/L
dbacp05170 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05171 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 25 mg/L
dbacp05172 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 15 % Cytotoxicity at 12.5 mg/L
dbacp05173 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 5 % Cytotoxicity at 6.25 mg/L
dbacp05174 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 3.125 mg/L
dbacp05175 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 70 % Cytotoxicity at 50 mg/L
dbacp05176 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 60 % Cytotoxicity at 25 mg/L
dbacp05177 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 12.5 mg/L
dbacp05178 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 5 % Cytotoxicity at 6.25 mg/L
dbacp05179 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 1 % Cytotoxicity at 3.125 mg/L
dbacp05180 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 78 % Cytotoxicity at 50 mg/L
dbacp05181 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 70 % Cytotoxicity at 25 mg/L
dbacp05182 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 10 % Cytotoxicity at 12.5 mg/L
dbacp05183 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 10 % Cytotoxicity at 6.25 mg/L
dbacp05184 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 5 % Cytotoxicity at 3.125 mg/L
dbacp05185 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 82 % Cytotoxicity at 50 mg/L
dbacp05186 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 70 % Cytotoxicity at 25 mg/L
dbacp05187 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 18 % Cytotoxicity at 12.5 mg/L
dbacp05188 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 6.25 mg/L
dbacp05189 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 10 % Cytotoxicity at 3.125 mg/L
dbacp05190 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 90 % Cytotoxicity at 50 mg/L
dbacp05191 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 82 % Cytotoxicity at 25 mg/L
dbacp05192 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 18 % Cytotoxicity at 12.5 mg/L
dbacp05193 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 18 % Cytotoxicity at 6.25 mg/L
dbacp05194 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 18 % Cytotoxicity at 3.125 mg/L
dbacp05195 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 80 % Cytotoxicity at 50 mg/L
dbacp05196 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp05197 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 45 % Cytotoxicity at 12.5 mg/L
dbacp05198 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp05199 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 25 % Cytotoxicity at 3.125 mg/L
dbacp05200 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 84 % Cytotoxicity at 50 mg/L
dbacp05201 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 84% Cytotoxicity at 25 mg/L
dbacp05202 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 48 % Cytotoxicity at 12.5 mg/L
dbacp05203 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp05204 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 3.125 mg/L
dbacp05205 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05206 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp05207 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 12.5 mg/L
dbacp05208 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 6.25 mg/L
dbacp05209 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 15 % Cytotoxicity at 3.125 mg/L
dbacp05210 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05211 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 25 mg/L
dbacp05212 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 20 % Cytotoxicity at 12.5 mg/L
dbacp05213 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 1 % Cytotoxicity at 6.25 mg/L
dbacp05214 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 3.125 mg/L