dbACP: A Comprehensive Database of Anti-Cancer Peptides

57 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06913 AC-P19M FAKKLAKLKKKLAKLAKKR Synthetic analogue of AC-P19 Inhibition of cell signalling WST-8 assay A-549 Lung Cancer IC50 = 9.84 µM
dbacp06914 AC-P19M FAKKLAKLKKKLAKLAKKR Synthetic analogue of AC-P19 Inhibition of cell signalling WST-8 assay H-460 Lung Cancer IC50 = 6.29 µM
dbacp06915 AC-P19 FAKKLAKLKKKLAKLALAL Synthetic Inhibition of cell signalling WST-8 assay A-549 Lung Cancer IC50 = 52.14 µM
dbacp06916 AC-P19 FAKKLAKLKKKLAKLALAL Synthetic Inhibition of cell signalling WST-8 assay H-460 Lung Cancer IC50 = 49.08 µM
dbacp06919 Q7 EQQQQQQPQNRRFRE Pisum sativum Inhibition of cell signalling MTT assay HEC-1-A Endometrial Cancer IC50 = 129.82 ± 7.53 μM
dbacp06924 #2(D33-N52) RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-B
dbacp06925 #2(D33-N52) RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay MCF-7 Breast Cancer Graph figure 1-B
dbacp06926 #5(D93-F112) RRRRRRRRGGDQEIKFKVETLECREMWKGF STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-B
dbacp06927 #6(M108-L127) RRRRRRRRGGMWKGFILTVVELRVPTDLTL STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-B
dbacp06928 #6(M108-L127) RRRRRRRRGGMWKGFILTVVELRVPTDLTL STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay MCF-7 Breast Cancer Graph figure 1-B
dbacp06929 2A(F39-Q58) RRRRRRRRGGFWAGLQGLTIYFYNSNRDFQ STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-C
dbacp06930 2C(Q44-Q58) RRRRRRRRGGQGLTIYFYNSNRDFQ STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-C
dbacp06931 2D(Q44-R55) RRRRRRRRGGQGLTIYFYNSNR STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-C
dbacp06932 2D2(Q44-Y51) RRRRRRRRGGQGLTIYFY STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-C
dbacp06933 2D3(G45-N52) RRRRRRRRGGGLTIYFYN STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-C
dbacp06934 2D5(G45-Y51) RRRRRRRRGGGLTIYFY STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer IC50 = 19.4 μM
dbacp06935 6E(V116-M135) RRRRRRRRGGVVELRVPTDLTLLPGHLYMM STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-D
dbacp06936 6F (I113-P122) RRRRRRRRGGILTVVELRVP STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-D
dbacp06937 TAT-2D5 GRKKRRQRRRPPQGGLTIYFY STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-G
dbacp06938 HTLV-II-Rex-2D5 TRRQRTRRARRNRGGLTIYFY STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-G
dbacp06939 FHV-2D5 RRRRNRTRRNRRRVRGGLTIYFY STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-G
dbacp06945 LJP-6 FKEHGY Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 3.06 ± 0.31 mM
dbacp06946 LJP-1 EGFHL Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 0.48 ± 0.05 mM
dbacp06947 LJP-1 EGFHL Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 0.45 ± 0.05 mM
dbacp06948 LJP-1 EGFHL Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 0.36 ± 0.03 mM
dbacp06949 LJP-8 FSHTYV Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 0.44 ± 0.04 mM
dbacp06950 LJP-8 FSHTYV Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 0.63 ± 0.05 mM
dbacp06951 LJP-8 FSHTYV Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 0.76 ± 0.08 mM
dbacp06952 LJP-2 LWEHSH Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 2.25 ± 0.22 mM
dbacp06953 LJP-2 LWEHSH Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 1.71 ± 0.13 mM
dbacp06954 LJP-2 LWEHSH Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 0.62 ± 0.05 mM
dbacp06955 LJP-3 FSHRGH Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 1.42 ± 0.12 mM
dbacp06956 LJP-3 FSHRGH Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 1.70 ± 0.15 mM
dbacp06957 LJP-5 FSTHGG Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 2.44 ± 0.22 mM
dbacp06958 LJP-5 FSTHGG Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 2.78 ± 0.26 mM
dbacp06959 LJP-5 FSTHGG Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 1.49 ± 0.13 mM
dbacp06960 LJP-7 HAGYSWA Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 2.53 ± 0.24 mM
dbacp06961 LJP-7 HAGYSWA Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 1.66 ± 0.11 mM
dbacp06962 LJP-7 HAGYSWA Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 1.44 ± 0.12 mM
dbacp06963 LJP-9 FEHSG Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 0.53 ± 0.05 mM
dbacp06964 LJP-9 FEHSG Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 0.69 ± 0.08 mM
dbacp06965 LJP-9 FEHSG Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 0.51 ± 0.07 mM
dbacp06966 LJP-10 HASWEH Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 3.52 ± 0.35 mM
dbacp06967 LJP-10 HASWEH Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 2.69 ± 0.22 mM
dbacp06968 LJP-10 HASWEH Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 3.53 ± 0.34 mM
dbacp06969 LJP-11 YEHSHG Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 0.49 ± 0.05 mM
dbacp06970 LJP-11 YEHSHG Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 0.61 ± 0.07 mM
dbacp06971 LJP-11 YEHSHG Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 0.70 ± 0.07 mM
dbacp06972 LJP-12 TFKHG Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 0.41 ± 0.04 mM
dbacp06973 LJP-12 TFKHG Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 0.60 ± 0.08 mM
dbacp06974 LJP-12 TFKHG Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 0.72 ± 0.05 mM
dbacp06975 C16-E4Y EEEEY Synthetic Inhibition of cell signalling WST-8 assay A-431 Skin Cancer 10 % cell viability at 0.05 wt %
dbacp06976 C16-E4Y EEEEY Synthetic Inhibition of cell signalling WST-8 assay HeLa Cervical Cancer 60% cell viability at 0.05 wt %
dbacp06977 C16-E4Y EEEEY Synthetic Inhibition of cell signalling WST-8 assay HepG-2 Liver Cancer 50 % cell viability at 0.05 wt %
dbacp06978 C16-E4Y EEEEY Synthetic Inhibition of cell signalling WST-8 assay MCF-7 Breast Cancer 50 % cell viability at 0.05 wt %
dbacp07004 Rapeseed peptide NDGNQPL extracted from rapeseed protein Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 1.56 mmol/L
dbacp07005 Rapeseed peptide NDGNQPL extracted from rapeseed protein Inhibition of cell signalling Apoptosis assay HepG-2 Liver Cancer 28.39 ± 0.80% apoptosis rate at 0.5 mmol/L