57 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp06913 | AC-P19M | FAKKLAKLKKKLAKLAKKR | Synthetic analogue of AC-P19 | Inhibition of cell signalling | WST-8 assay | A-549 | Lung Cancer | IC50 = 9.84 µM |
| dbacp06914 | AC-P19M | FAKKLAKLKKKLAKLAKKR | Synthetic analogue of AC-P19 | Inhibition of cell signalling | WST-8 assay | H-460 | Lung Cancer | IC50 = 6.29 µM |
| dbacp06915 | AC-P19 | FAKKLAKLKKKLAKLALAL | Synthetic | Inhibition of cell signalling | WST-8 assay | A-549 | Lung Cancer | IC50 = 52.14 µM |
| dbacp06916 | AC-P19 | FAKKLAKLKKKLAKLALAL | Synthetic | Inhibition of cell signalling | WST-8 assay | H-460 | Lung Cancer | IC50 = 49.08 µM |
| dbacp06919 | Q7 | EQQQQQQPQNRRFRE | Pisum sativum | Inhibition of cell signalling | MTT assay | HEC-1-A | Endometrial Cancer | IC50 = 129.82 ± 7.53 μM |
| dbacp06924 | #2(D33-N52) | RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-B |
| dbacp06925 | #2(D33-N52) | RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | MCF-7 | Breast Cancer | Graph figure 1-B |
| dbacp06926 | #5(D93-F112) | RRRRRRRRGGDQEIKFKVETLECREMWKGF | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-B |
| dbacp06927 | #6(M108-L127) | RRRRRRRRGGMWKGFILTVVELRVPTDLTL | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-B |
| dbacp06928 | #6(M108-L127) | RRRRRRRRGGMWKGFILTVVELRVPTDLTL | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | MCF-7 | Breast Cancer | Graph figure 1-B |
| dbacp06929 | 2A(F39-Q58) | RRRRRRRRGGFWAGLQGLTIYFYNSNRDFQ | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-C |
| dbacp06930 | 2C(Q44-Q58) | RRRRRRRRGGQGLTIYFYNSNRDFQ | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-C |
| dbacp06931 | 2D(Q44-R55) | RRRRRRRRGGQGLTIYFYNSNR | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-C |
| dbacp06932 | 2D2(Q44-Y51) | RRRRRRRRGGQGLTIYFY | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-C |
| dbacp06933 | 2D3(G45-N52) | RRRRRRRRGGGLTIYFYN | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-C |
| dbacp06934 | 2D5(G45-Y51) | RRRRRRRRGGGLTIYFY | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | IC50 = 19.4 μM |
| dbacp06935 | 6E(V116-M135) | RRRRRRRRGGVVELRVPTDLTLLPGHLYMM | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-D |
| dbacp06936 | 6F (I113-P122) | RRRRRRRRGGILTVVELRVP | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-D |
| dbacp06937 | TAT-2D5 | GRKKRRQRRRPPQGGLTIYFY | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-G |
| dbacp06938 | HTLV-II-Rex-2D5 | TRRQRTRRARRNRGGLTIYFY | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-G |
| dbacp06939 | FHV-2D5 | RRRRNRTRRNRRRVRGGLTIYFY | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-G |
| dbacp06945 | LJP-6 | FKEHGY | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 3.06 ± 0.31 mM |
| dbacp06946 | LJP-1 | EGFHL | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 0.48 ± 0.05 mM |
| dbacp06947 | LJP-1 | EGFHL | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 0.45 ± 0.05 mM |
| dbacp06948 | LJP-1 | EGFHL | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 0.36 ± 0.03 mM |
| dbacp06949 | LJP-8 | FSHTYV | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 0.44 ± 0.04 mM |
| dbacp06950 | LJP-8 | FSHTYV | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 0.63 ± 0.05 mM |
| dbacp06951 | LJP-8 | FSHTYV | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 0.76 ± 0.08 mM |
| dbacp06952 | LJP-2 | LWEHSH | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 2.25 ± 0.22 mM |
| dbacp06953 | LJP-2 | LWEHSH | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 1.71 ± 0.13 mM |
| dbacp06954 | LJP-2 | LWEHSH | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 0.62 ± 0.05 mM |
| dbacp06955 | LJP-3 | FSHRGH | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 1.42 ± 0.12 mM |
| dbacp06956 | LJP-3 | FSHRGH | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 1.70 ± 0.15 mM |
| dbacp06957 | LJP-5 | FSTHGG | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 2.44 ± 0.22 mM |
| dbacp06958 | LJP-5 | FSTHGG | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 2.78 ± 0.26 mM |
| dbacp06959 | LJP-5 | FSTHGG | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 1.49 ± 0.13 mM |
| dbacp06960 | LJP-7 | HAGYSWA | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 2.53 ± 0.24 mM |
| dbacp06961 | LJP-7 | HAGYSWA | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 1.66 ± 0.11 mM |
| dbacp06962 | LJP-7 | HAGYSWA | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 1.44 ± 0.12 mM |
| dbacp06963 | LJP-9 | FEHSG | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 0.53 ± 0.05 mM |
| dbacp06964 | LJP-9 | FEHSG | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 0.69 ± 0.08 mM |
| dbacp06965 | LJP-9 | FEHSG | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 0.51 ± 0.07 mM |
| dbacp06966 | LJP-10 | HASWEH | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 3.52 ± 0.35 mM |
| dbacp06967 | LJP-10 | HASWEH | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 2.69 ± 0.22 mM |
| dbacp06968 | LJP-10 | HASWEH | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 3.53 ± 0.34 mM |
| dbacp06969 | LJP-11 | YEHSHG | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 0.49 ± 0.05 mM |
| dbacp06970 | LJP-11 | YEHSHG | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 0.61 ± 0.07 mM |
| dbacp06971 | LJP-11 | YEHSHG | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 0.70 ± 0.07 mM |
| dbacp06972 | LJP-12 | TFKHG | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 0.41 ± 0.04 mM |
| dbacp06973 | LJP-12 | TFKHG | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 0.60 ± 0.08 mM |
| dbacp06974 | LJP-12 | TFKHG | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 0.72 ± 0.05 mM |
| dbacp06975 | C16-E4Y | EEEEY | Synthetic | Inhibition of cell signalling | WST-8 assay | A-431 | Skin Cancer | 10 % cell viability at 0.05 wt % |
| dbacp06976 | C16-E4Y | EEEEY | Synthetic | Inhibition of cell signalling | WST-8 assay | HeLa | Cervical Cancer | 60% cell viability at 0.05 wt % |
| dbacp06977 | C16-E4Y | EEEEY | Synthetic | Inhibition of cell signalling | WST-8 assay | HepG-2 | Liver Cancer | 50 % cell viability at 0.05 wt % |
| dbacp06978 | C16-E4Y | EEEEY | Synthetic | Inhibition of cell signalling | WST-8 assay | MCF-7 | Breast Cancer | 50 % cell viability at 0.05 wt % |
| dbacp07004 | Rapeseed peptide | NDGNQPL | extracted from rapeseed protein | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 1.56 mmol/L |
| dbacp07005 | Rapeseed peptide | NDGNQPL | extracted from rapeseed protein | Inhibition of cell signalling | Apoptosis assay | HepG-2 | Liver Cancer | 28.39 ± 0.80% apoptosis rate at 0.5 mmol/L |