dbACP: A Comprehensive Database of Anti-Cancer Peptides

4 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02338 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Isolated from the giant silk moth, cecropia moth Membrane damage; Apoptotic cell death; Necrosis MTT/MTS assay SCC12 Skin cancer IC50 : 1 µM
dbacp02339 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Isolated from the giant silk moth, cecropia moth Membrane damage; Apoptotic cell death; Necrosis MTT/MTS assay SCC25 Skin cancer IC50 : 2.2 µM
dbacp02340 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Isolated from the giant silk moth, cecropia moth Membrane damage; Apoptotic cell death; Necrosis Cell viability assay SCC25 Skin cancer 0.6 ± 0.6% cell growth inhibition at 10 µM
dbacp02341 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Isolated from the giant silk moth, cecropia moth Membrane damage; Apoptotic cell death; Necrosis Cell viability assay SCC25 Skin cancer 107.0 ± 5.0% cell growth inhibition at 1 µM