dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01198 ATAP-iRGD-M6 KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 3.1 μM
dbacp01200 ATAP-iRGD-M8 KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 2.1 μM