dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06516 Viscotoxin 1-PS KSCCPNTTGRNIYNTCRFGGGSREVCARISGCKIISASTCPSDYPK European mistletoe Cell membrane disintegration Not specified Not found Breast cancer Not found
dbacp06517 Viscotoxin 1-Ps KSCCPNTTGRNIYNTCRFGGGSREVCARISGCKIISASTCPSDYPK The European mistletoe Cell membrane disintegration Not specified Not found Colorectal cancer Not found