2 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp06516 | Viscotoxin 1-PS | KSCCPNTTGRNIYNTCRFGGGSREVCARISGCKIISASTCPSDYPK | European mistletoe | Cell membrane disintegration | Not specified | Not found | Breast cancer | Not found |
| dbacp06517 | Viscotoxin 1-Ps | KSCCPNTTGRNIYNTCRFGGGSREVCARISGCKIISASTCPSDYPK | The European mistletoe | Cell membrane disintegration | Not specified | Not found | Colorectal cancer | Not found |