dbACP: A Comprehensive Database of Anti-Cancer Peptides

6 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05106 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05110 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05114 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05118 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05122 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05126 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM