dbACP: A Comprehensive Database of Anti-Cancer Peptides

37 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01296 Aurein-1.3 GLFDIIKKIAESF Southern bell frog Cell membrane disintegration One-dose and five-dose assay MDA-MB-435 Melanoma IC50 : 5 μM
dbacp01999 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay MDA-MB-435 Breast cancer IC50 : 11.3 µg/ml
dbacp02057 Buforin Iib RAGLQFPVGRLLRRLLRRLLR Not found Inducing apoptosis MTT/MTS assay MDA-MB-435 Not specified IC50 : 11.3 µg/ml
dbacp02535 CNGRC-GG-D(KLAKLAK)3 CNGRCGGKLAKLAKKLAKLAK Not found Inducing apoptosis Internalization assay, Mitochondrial swelling assay, Cell-free apoptosis assay, Caspase activation assay MDA-MB-435 Not specified LC50 : 415 Μm
dbacp02651 Dermaseptin PS4 MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ Sauvage's leaf frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay MDA-MB-435S Lung cancer MIC : 10−9 to 10−4 M
dbacp02681 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay MDA-MB-435S Not specified IC50 : 9.94 μM
dbacp02686 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay MDA-MB-435S Breast cancer IC50 : 9.94 μM
dbacp02727 Dermaseptin-PS4 ALWKTLLKHVGKAAGKAALNAVTDMVNQ Waxy monkey tree frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay MDA-MB-435S Lung cancer MIC : 10−9 to 10−4 M
dbacp03524 KLAK peptide KLAKLAKKLAKLAK Not found Inducing apoptosis Internalization assay,Mitochondrial swelling assay,Cell-free apoptosis assay,Caspase activation assay MDA-MB-435 Not specified LC50 : 333 Μm
dbacp03744 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay MDA-MB-435 Leukemia Not found
dbacp04579 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay MDA-MB-435S Breast cancer MIC : 6.26 - 36.65 μM
dbacp04585 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay MDA-MB-435S Breast cancer IC50 : < 4 μM
dbacp05548 Phylloseptin-PHa FLSLIPAAISAVSALANHF Northern orange-legged leaf frog Disruption of the membrane MTT assay, Lactate dehydrogenase (LDH) assay MDA-MB-435 Melanocyte LD50 : < 5 µM
dbacp05907 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay MDA-MB-435S Breast cancer IC50 : 15.44 µM
dbacp06270 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay MDA-MB-435s Lung cancer TI : 10μM
dbacp06274 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay MDA-MB-435s Human neuronal glioblastoma TI : 10μM
dbacp06278 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay MDA-MB-435s Human prostate carcinoma TI : 10μM
dbacp06282 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay MDA-MB-435s Melanoma TI : 10μM
dbacp06286 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay MDA-MB-435s Melanoma TI : approx. 10μM
dbacp07341 D-melittin gigavlkvlttglpaliswikrkrqqc Synthetic pH-triggered release, membrane lysis, immunogenic death MTS assay MDA-MB-435 WT Breast Cancer IC50 = 3.5 µM
dbacp07342 D-melittin gigavlkvlttglpaliswikrkrqqc Synthetic pH-triggered release, membrane lysis, immunogenic death MTS assay MDA-MB-435 DOX-R Breast Cancer IC50 = 3.4 µM
dbacp07502 Brevinin-1Ha FALGAVTCLIRTKCKVLPKLF Analogue of Brevinin-1H α-helix enhances antimicrobial, anticancer activity MTT assay MDA-MB-435S Breast Cancer IC50 = 214.7 µM
dbacp07506 Brevinin-1HY FALGAVTKVLYKLFCLITRKC Analogue of Brevinin-1H α-helix enhances antimicrobial, anticancer activity MTT assay MDA-MB-435S Breast Cancer IC50 = 2.243 µM
dbacp07806 cT1 KWCFRVCYRGICYRRCRG Synthetic Not Available Resazurin dye assay MDA-MB-435S Skin Cancer CC50 = 2.7 ± 0.3 µM
dbacp07811 [R/K]cT1 KWCFKVCYKGICYKKCKG Synthetic Not Available Resazurin dye assay MDA-MB-435S Skin Cancer CC50 = 3.5 ± 0.4 µM
dbacp07817 [W2S]cT1 KSCFRVCYRGICYRRCRG Synthetic Not Available Resazurin dye assay MDA-MB-435S Skin Cancer CC50 = 18.9 ± 0.9 µM
dbacp07824 [R9S]cT1 KWCFRVCYSGICYRRCRG Synthetic Not Available Resazurin dye assay MDA-MB-435S Skin Cancer CC50 = 5.3 ± 0.6 µM
dbacp07828 [R14S]cT1 KWCFRVCYRGICYSRCRG Synthetic Not Available Resazurin dye assay MDA-MB-435S Skin Cancer CC50 = 3.5 ± 0.3 µM
dbacp07833 [R17S]cT1 KWCFRVCYRGICYRRCSG Synthetic Not Available Resazurin dye assay MDA-MB-435S Skin Cancer CC50 = 4.5 ± 0.3 µM
dbacp07926 Phylloseptin-PBa3 FLSLIPHIVSGVAALANHL Phyllomedusa burmeisteri Membrane disruption, apoptosis, selective cytotoxicity MTT assay MDA-MB-435S Breast Cancer IC50 = 208 µM
dbacp07953 S-24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Synthetic Analogue of Ranatuerin-2PLx R2PLx induces caspase-dependent apoptosis MTT assay MDA-MB-435S Skin Cancer IC50 = 179.00 µM
dbacp08067 Temporin-PE FLPIVAKLLSGLL Pelophylax kl. esculentus Modulates membrane interactions MTT assay MDA-MB-435S Skin Cancer IC50 = 33.23 μM
dbacp08071 temporin-PEa FLYIVAKLLSGLL Synthetic analog of Temporin-PE Modulates membrane interactions MTT assay MDA-MB-435S Skin Cancer IC50 = 9.864 μM
dbacp08075 temporin-PEb FLPIVAKLLSGLLGRKKRRQRRR Synthetic analog of Temporin-PE Modulates membrane interactions MTT assay MDA-MB-435S Skin Cancer IC50 = 3.483 μM
dbacp08080 APETx4 GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD Anthopleura elegantissima Not Available CellTox Green Dye assay MDA-MB-435S Skin Cancer Green object count < 100 /mm2 at 20 μM
dbacp08144 MccJ25-18-4 GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL Synthetic Apoptosis inducing MTT assay MDA-MB-435 Breast Cancer IC50 = 20.0 ± 0.5 μM
dbacp08145 MccJ25-18-4 GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL Synthetic Apoptosis inducing MTT assay MDA-MB-435-MDR Breast Cancer IC50 = 25.0 ± 0.5 μM