26 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02651 | Dermaseptin PS4 | MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ | Sauvage's leaf frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | MDA-MB-435S | Lung cancer | MIC : 10−9 to 10−4 M |
| dbacp02681 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | MDA-MB-435S | Not specified | IC50 : 9.94 μM |
| dbacp02686 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | MDA-MB-435S | Breast cancer | IC50 : 9.94 μM |
| dbacp02727 | Dermaseptin-PS4 | ALWKTLLKHVGKAAGKAALNAVTDMVNQ | Waxy monkey tree frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | MDA-MB-435S | Lung cancer | MIC : 10−9 to 10−4 M |
| dbacp04579 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MDA-MB-435S | Breast cancer | MIC : 6.26 - 36.65 μM |
| dbacp04585 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MDA-MB-435S | Breast cancer | IC50 : < 4 μM |
| dbacp05907 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MDA-MB-435S | Breast cancer | IC50 : 15.44 µM |
| dbacp06270 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | MDA-MB-435s | Lung cancer | TI : 10μM |
| dbacp06274 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | MDA-MB-435s | Human neuronal glioblastoma | TI : 10μM |
| dbacp06278 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | MDA-MB-435s | Human prostate carcinoma | TI : 10μM |
| dbacp06282 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | MDA-MB-435s | Melanoma | TI : 10μM |
| dbacp06286 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | MDA-MB-435s | Melanoma | TI : approx. 10μM |
| dbacp07502 | Brevinin-1Ha | FALGAVTCLIRTKCKVLPKLF | Analogue of Brevinin-1H | α-helix enhances antimicrobial, anticancer activity | MTT assay | MDA-MB-435S | Breast Cancer | IC50 = 214.7 µM |
| dbacp07506 | Brevinin-1HY | FALGAVTKVLYKLFCLITRKC | Analogue of Brevinin-1H | α-helix enhances antimicrobial, anticancer activity | MTT assay | MDA-MB-435S | Breast Cancer | IC50 = 2.243 µM |
| dbacp07806 | cT1 | KWCFRVCYRGICYRRCRG | Synthetic | Not Available | Resazurin dye assay | MDA-MB-435S | Skin Cancer | CC50 = 2.7 ± 0.3 µM |
| dbacp07811 | [R/K]cT1 | KWCFKVCYKGICYKKCKG | Synthetic | Not Available | Resazurin dye assay | MDA-MB-435S | Skin Cancer | CC50 = 3.5 ± 0.4 µM |
| dbacp07817 | [W2S]cT1 | KSCFRVCYRGICYRRCRG | Synthetic | Not Available | Resazurin dye assay | MDA-MB-435S | Skin Cancer | CC50 = 18.9 ± 0.9 µM |
| dbacp07824 | [R9S]cT1 | KWCFRVCYSGICYRRCRG | Synthetic | Not Available | Resazurin dye assay | MDA-MB-435S | Skin Cancer | CC50 = 5.3 ± 0.6 µM |
| dbacp07828 | [R14S]cT1 | KWCFRVCYRGICYSRCRG | Synthetic | Not Available | Resazurin dye assay | MDA-MB-435S | Skin Cancer | CC50 = 3.5 ± 0.3 µM |
| dbacp07833 | [R17S]cT1 | KWCFRVCYRGICYRRCSG | Synthetic | Not Available | Resazurin dye assay | MDA-MB-435S | Skin Cancer | CC50 = 4.5 ± 0.3 µM |
| dbacp07926 | Phylloseptin-PBa3 | FLSLIPHIVSGVAALANHL | Phyllomedusa burmeisteri | Membrane disruption, apoptosis, selective cytotoxicity | MTT assay | MDA-MB-435S | Breast Cancer | IC50 = 208 µM |
| dbacp07953 | S-24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Synthetic Analogue of Ranatuerin-2PLx | R2PLx induces caspase-dependent apoptosis | MTT assay | MDA-MB-435S | Skin Cancer | IC50 = 179.00 µM |
| dbacp08067 | Temporin-PE | FLPIVAKLLSGLL | Pelophylax kl. esculentus | Modulates membrane interactions | MTT assay | MDA-MB-435S | Skin Cancer | IC50 = 33.23 μM |
| dbacp08071 | temporin-PEa | FLYIVAKLLSGLL | Synthetic analog of Temporin-PE | Modulates membrane interactions | MTT assay | MDA-MB-435S | Skin Cancer | IC50 = 9.864 μM |
| dbacp08075 | temporin-PEb | FLPIVAKLLSGLLGRKKRRQRRR | Synthetic analog of Temporin-PE | Modulates membrane interactions | MTT assay | MDA-MB-435S | Skin Cancer | IC50 = 3.483 μM |
| dbacp08080 | APETx4 | GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD | Anthopleura elegantissima | Not Available | CellTox Green Dye assay | MDA-MB-435S | Skin Cancer | Green object count < 100 /mm2 at 20 μM |