dbACP: A Comprehensive Database of Anti-Cancer Peptides

56 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01160 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay NCIeH157 Human squamous carcinoma IC50 : 0.83 - 2.0 μM
dbacp01161 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay NCIeH838 Human Lung adenocarcinoma IC50 : 0.83 - 2.0 μM
dbacp01162 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay PC-3 androgen-independent Prostate adenocarcinoma IC50 : 0.83 - 2.0 μM
dbacp01163 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay MCF-7 Human breast carcinoma IC50 : 0.83 - 2.0 μM
dbacp01164 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay U251 Human glioblastoma IC50 : 0.83 - 2.0 μM
dbacp02779 Distinctin-Like-Peptide-PH NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN Skin Secretion, Northern orange-legged leaf frog, South America Membrane lysis via pore formation MTT Cell viability assay, LDH assay H157 Prostate carcinoma MIC : ≥ 4.197 μM
dbacp02780 Distinctin-Like-Peptide-PH NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN Skin Secretion, Northern orange-legged leaf frog, South America Membrane lysis via pore formation MTT Cell viability assay, LDH assay H158 Prostate carcinoma IC50 : 15.41 μg/mL
dbacp02781 Distinctin-Like-Peptide-PH NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN Skin Secretion, Northern orange-legged leaf frog, South America Membrane lysis via pore formation MTT Cell viability assay, LDH assay PC3 Lung cancer MIC : ≥ 4.197 μM
dbacp02782 Distinctin-Like-Peptide-PH NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN Skin Secretion, Northern orange-legged leaf frog, South America Membrane lysis via pore formation MTT Cell viability assay, LDH assay PC3 Lung cancer IC50 : 32.25 μg/mL
dbacp04578 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay H157 Lung cancer MIC : 6.26 - 36.65 μM
dbacp04579 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay MDA-MB-435S Breast cancer MIC : 6.26 - 36.65 μM
dbacp04580 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay PC-3 Human prostate carcinoma MIC : 6.26 - 36.65 μM
dbacp04581 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay U251-MG Glioma MIC : 6.26 - 36.65 μM
dbacp04582 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay MCF-7 Breast cancer MIC : 6.26 - 36.65 μM
dbacp04583 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay HMEC-1 Glioma MIC : 6.26 - 36.65 μM
dbacp04584 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay H157 Lung cancer IC50 : < 4 μM
dbacp04585 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay MDA-MB-435S Breast cancer IC50 : < 4 μM
dbacp04586 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay PC-3 Human prostate carcinoma IC50 : < 4 μM
dbacp04587 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay U251-MG Glioma IC50 : < 4 μM
dbacp04588 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay MCF-7 Breast cancer IC50 : < 4 μM
dbacp04589 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay HMEC-1 Glioma IC50 : < 4 μM
dbacp05525 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay U145 Prostate cancer IC50 : approx. 0.29 µM
dbacp05526 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay PC3 Prostate cancer IC50 : approx. 0.29 µM
dbacp05527 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay LNCaP Prostate cancer IC50 : approx. 0.29 µM
dbacp05528 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H838 Lung cancer IC50 : approx. 0.29 µM
dbacp05529 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H460 Lung cancer IC50 : approx. 0.29 µM
dbacp05530 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H23 Lung cancer IC50 : approx. 0.29 µM
dbacp05531 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H157 Lung cancer IC50 : approx. 0.29 µM
dbacp05532 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MB231 Breast cancer IC50 : approx. 0.29 µM
dbacp05533 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MB435s Breast cancer IC50 : approx. 0.29 µM
dbacp05534 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MCF-7 Breast cancer IC50 : approx. 0.29 µM
dbacp05535 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay U251MG Neurospongioma IC50 : approx. 0.29 µM
dbacp05536 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay U145 Prostate cancer IC50 : approx. 0.50 µM
dbacp05537 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay PC3 Prostate cancer IC50 : approx. 0.50 µM
dbacp05538 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay LNCaP Prostate cancer IC50 : approx. 0.50 µM
dbacp05539 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H838 Lung cancer IC50 : approx. 0.50 µM
dbacp05540 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H460 Lung cancer IC50 : approx. 0.50 µM
dbacp05541 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H23 Lung cancer IC50 : approx. 0.50 µM
dbacp05542 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H157 Lung cancer IC50 : approx. 0.50 µM
dbacp05543 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MB231 Breast cancer IC50 : approx. 0.50 µM
dbacp05544 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MB435s Breast cancer IC50 : approx. 0.50 µM
dbacp05545 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MCF-7 Breast cancer IC50 : approx. 0.50 µM
dbacp05546 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay U251MG neurospongioma IC50 : approx. 0.50 µM
dbacp05547 Phylloseptin-PHa FLSLIPAAISAVSALANHF Skin secretions, Orange-legged Leaf Frog, South America Membrane disruption MTT cell viability assay NCI-H157 Lung cancer IC50 : 14.10 μM
dbacp05554 Phylloseptin-PTa FLSLIPKIAGGIAALAKHL Skin secretions, the Brown-bellied Leaf Frog, South America Membrane disruption MTT Cell viability assay NCI-H157 Lung cancer IC50 : 6.73 μM
dbacp05901 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Gram-negative purple non-sulfur bacteria Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay H157 Lung IC50 : 5.90 µM
dbacp05902 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Gram-negative purple non-sulfur bacteria Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay MBD-MB-435s Melanocyte IC50 : 15.44 µM
dbacp05903 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Gram-negative purple non-sulfur bacteria Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay PC-3 Human prostate carcinoma IC50 : 5.79 µM
dbacp05904 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Gram-negative purple non-sulfur bacteria Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay U251-MG Human glioblastoma astrocytoma IC50 : 16.14 µm
dbacp05905 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Gram-negative purple non-sulfur bacteria Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay MCF-7 Human breast cancer IC50 : 20.19 µM
dbacp05906 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay H157 Lung cancer IC50 : 5.90 µM
dbacp05907 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay MDA-MB-435S Breast cancer IC50 : 15.44 µM
dbacp05908 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay PC-3 Human prostate carcinoma IC50 : 5.79 µM
dbacp05909 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay U251-MG Glioma IC50 : 16.14 µM
dbacp05910 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay MCF-7 Breast cancer IC50 : 20.19 µM
dbacp05911 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay HMEC-1 Glioma IC50 : 79.50 µM