56 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01160 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | NCIeH157 | Human squamous carcinoma | IC50 : 0.83 - 2.0 μM |
| dbacp01161 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | NCIeH838 | Human Lung adenocarcinoma | IC50 : 0.83 - 2.0 μM |
| dbacp01162 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | PC-3 | androgen-independent Prostate adenocarcinoma | IC50 : 0.83 - 2.0 μM |
| dbacp01163 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | MCF-7 | Human breast carcinoma | IC50 : 0.83 - 2.0 μM |
| dbacp01164 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | U251 | Human glioblastoma | IC50 : 0.83 - 2.0 μM |
| dbacp02779 | Distinctin-Like-Peptide-PH | NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN | Skin Secretion, Northern orange-legged leaf frog, South America | Membrane lysis via pore formation | MTT Cell viability assay, LDH assay | H157 | Prostate carcinoma | MIC : ≥ 4.197 μM |
| dbacp02780 | Distinctin-Like-Peptide-PH | NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN | Skin Secretion, Northern orange-legged leaf frog, South America | Membrane lysis via pore formation | MTT Cell viability assay, LDH assay | H158 | Prostate carcinoma | IC50 : 15.41 μg/mL |
| dbacp02781 | Distinctin-Like-Peptide-PH | NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN | Skin Secretion, Northern orange-legged leaf frog, South America | Membrane lysis via pore formation | MTT Cell viability assay, LDH assay | PC3 | Lung cancer | MIC : ≥ 4.197 μM |
| dbacp02782 | Distinctin-Like-Peptide-PH | NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN | Skin Secretion, Northern orange-legged leaf frog, South America | Membrane lysis via pore formation | MTT Cell viability assay, LDH assay | PC3 | Lung cancer | IC50 : 32.25 μg/mL |
| dbacp04578 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | H157 | Lung cancer | MIC : 6.26 - 36.65 μM |
| dbacp04579 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MDA-MB-435S | Breast cancer | MIC : 6.26 - 36.65 μM |
| dbacp04580 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | PC-3 | Human prostate carcinoma | MIC : 6.26 - 36.65 μM |
| dbacp04581 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | U251-MG | Glioma | MIC : 6.26 - 36.65 μM |
| dbacp04582 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MCF-7 | Breast cancer | MIC : 6.26 - 36.65 μM |
| dbacp04583 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | HMEC-1 | Glioma | MIC : 6.26 - 36.65 μM |
| dbacp04584 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | H157 | Lung cancer | IC50 : < 4 μM |
| dbacp04585 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MDA-MB-435S | Breast cancer | IC50 : < 4 μM |
| dbacp04586 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | PC-3 | Human prostate carcinoma | IC50 : < 4 μM |
| dbacp04587 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | U251-MG | Glioma | IC50 : < 4 μM |
| dbacp04588 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MCF-7 | Breast cancer | IC50 : < 4 μM |
| dbacp04589 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | HMEC-1 | Glioma | IC50 : < 4 μM |
| dbacp05525 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | U145 | Prostate cancer | IC50 : approx. 0.29 µM |
| dbacp05526 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | PC3 | Prostate cancer | IC50 : approx. 0.29 µM |
| dbacp05527 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | LNCaP | Prostate cancer | IC50 : approx. 0.29 µM |
| dbacp05528 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H838 | Lung cancer | IC50 : approx. 0.29 µM |
| dbacp05529 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H460 | Lung cancer | IC50 : approx. 0.29 µM |
| dbacp05530 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H23 | Lung cancer | IC50 : approx. 0.29 µM |
| dbacp05531 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H157 | Lung cancer | IC50 : approx. 0.29 µM |
| dbacp05532 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | MB231 | Breast cancer | IC50 : approx. 0.29 µM |
| dbacp05533 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | MB435s | Breast cancer | IC50 : approx. 0.29 µM |
| dbacp05534 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | MCF-7 | Breast cancer | IC50 : approx. 0.29 µM |
| dbacp05535 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | U251MG | Neurospongioma | IC50 : approx. 0.29 µM |
| dbacp05536 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | U145 | Prostate cancer | IC50 : approx. 0.50 µM |
| dbacp05537 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | PC3 | Prostate cancer | IC50 : approx. 0.50 µM |
| dbacp05538 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | LNCaP | Prostate cancer | IC50 : approx. 0.50 µM |
| dbacp05539 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H838 | Lung cancer | IC50 : approx. 0.50 µM |
| dbacp05540 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H460 | Lung cancer | IC50 : approx. 0.50 µM |
| dbacp05541 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H23 | Lung cancer | IC50 : approx. 0.50 µM |
| dbacp05542 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H157 | Lung cancer | IC50 : approx. 0.50 µM |
| dbacp05543 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | MB231 | Breast cancer | IC50 : approx. 0.50 µM |
| dbacp05544 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | MB435s | Breast cancer | IC50 : approx. 0.50 µM |
| dbacp05545 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | MCF-7 | Breast cancer | IC50 : approx. 0.50 µM |
| dbacp05546 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | U251MG | neurospongioma | IC50 : approx. 0.50 µM |
| dbacp05547 | Phylloseptin-PHa | FLSLIPAAISAVSALANHF | Skin secretions, Orange-legged Leaf Frog, South America | Membrane disruption | MTT cell viability assay | NCI-H157 | Lung cancer | IC50 : 14.10 μM |
| dbacp05554 | Phylloseptin-PTa | FLSLIPKIAGGIAALAKHL | Skin secretions, the Brown-bellied Leaf Frog, South America | Membrane disruption | MTT Cell viability assay | NCI-H157 | Lung cancer | IC50 : 6.73 μM |
| dbacp05901 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Gram-negative purple non-sulfur bacteria | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | H157 | Lung | IC50 : 5.90 µM |
| dbacp05902 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Gram-negative purple non-sulfur bacteria | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MBD-MB-435s | Melanocyte | IC50 : 15.44 µM |
| dbacp05903 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Gram-negative purple non-sulfur bacteria | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | PC-3 | Human prostate carcinoma | IC50 : 5.79 µM |
| dbacp05904 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Gram-negative purple non-sulfur bacteria | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | U251-MG | Human glioblastoma astrocytoma | IC50 : 16.14 µm |
| dbacp05905 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Gram-negative purple non-sulfur bacteria | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MCF-7 | Human breast cancer | IC50 : 20.19 µM |
| dbacp05906 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | H157 | Lung cancer | IC50 : 5.90 µM |
| dbacp05907 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MDA-MB-435S | Breast cancer | IC50 : 15.44 µM |
| dbacp05908 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | PC-3 | Human prostate carcinoma | IC50 : 5.79 µM |
| dbacp05909 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | U251-MG | Glioma | IC50 : 16.14 µM |
| dbacp05910 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MCF-7 | Breast cancer | IC50 : 20.19 µM |
| dbacp05911 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | HMEC-1 | Glioma | IC50 : 79.50 µM |