dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp04830 Neurotoxin BmK AGAP-SYPU2 VKDGYIVDDKNCAYFCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGRCNG Manchurian scorpion Blocker of chloride channels and can inhibit the migration of glioma cells Antitumor activity assays Ehrlich ascites cells Glioma ED50 : 1.42 mg/kg
dbacp04831 Neurotoxin BmK AGAP-SYPU2 VKDGYIVDDKNCAYFCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGRCNG Manchurian scorpion Blocker of chloride channels and can inhibit the migration of glioma cells Antitumor activity assays S-180 Fibrosarcoma ED50 : 4.0 mg/kg
dbacp06319 Toxin BmKT MNYLVFFSLALLLMTGVESVRDGYIADDKNCAYFCGRNAYCDDECKKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGKCNGG Manchurian scorpion Immunomodulatory activities Not specified Not found Not found Not found