3 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp04830 | Neurotoxin BmK AGAP-SYPU2 | VKDGYIVDDKNCAYFCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGRCNG | Manchurian scorpion | Blocker of chloride channels and can inhibit the migration of glioma cells | Antitumor activity assays | Ehrlich ascites cells | Glioma | ED50 : 1.42 mg/kg |
| dbacp04831 | Neurotoxin BmK AGAP-SYPU2 | VKDGYIVDDKNCAYFCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGRCNG | Manchurian scorpion | Blocker of chloride channels and can inhibit the migration of glioma cells | Antitumor activity assays | S-180 | Fibrosarcoma | ED50 : 4.0 mg/kg |
| dbacp06319 | Toxin BmKT | MNYLVFFSLALLLMTGVESVRDGYIADDKNCAYFCGRNAYCDDECKKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGKCNGG | Manchurian scorpion | Immunomodulatory activities | Not specified | Not found | Not found | Not found |