dbACP: A Comprehensive Database of Anti-Cancer Peptides

36 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02628 D-SVS-1 kvkvkvkvPptkvkvkvk Synthetic peptide Disruption of cell membranes MTT/MTS assay KB Oral cancer IC50 : 4.5 ± 0.5 µM
dbacp02784 dLL-37(17-32)c FKRIVQRIKDFLRNLV LL-37, a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Oral cancer Not found
dbacp03105 GM15 GGTCVIRGCVPKKLM Not found Inducing apoptosis MTT assay KB Oral cancer Not found
dbacp03289 HCAP18(109-135) FRKSKEKIGKEFKRIVQRIKDFLRNLV HCAP18 synthetic peptide Apoptosis inducing Not specified SAS-H1 Oral cancer Not found
dbacp03375 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Bovine lactoferrin (Lf-B) Induction of apoptosis WST-1 assay KB Oral cancer IC50 : 13.2 µMol/L
dbacp03396 Interferon gamma (IFN-gamma) MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAVKTGKRKRSQMLFRGRRASQ Chimpanzee Apoptosis; Immunomodulatory activity Not specified Not found Oral cancer Not found
dbacp03474 K4R2-Nal2-S1 Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay PC9-G Oral cancer MIC : 25 μM
dbacp03476 K4R2-Nal2-S1 Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay C9 Oral cancer MIC : 25 μM
dbacp03478 K4R2-Nal2-S1 Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay SAS Oral cancer MIC : 25 μM
dbacp03480 K6-Nal2-S1 Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay PC9-G Oral cancer MIC : 3.1 μM
dbacp03482 K6-Nal2-S1 Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay C9 Oral cancer MIC : 3.1 μM
dbacp03484 K6-Nal2-S1 Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay SAS Oral cancer MIC : 3.1 μM
dbacp04156 LL-37(1-12) LLGDFFRKSKEK LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Oral cancer Not found
dbacp04159 LL-37(1-4,17-27) LLGDFKRIVQRIKDF LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Oral cancer Not found
dbacp04162 LL-37(13-37) IGKEFKRIVQRIKDFLRNLVPRTES LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Oral cancer LC50 : 40 µM
dbacp04165 LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) IGKEFKRIVQRIKDFLRNLVPRTES Human Not specified MTT assay KB Oral cancer LC50 : 40 ± 0 μM
dbacp04168 LL-37(17-29) FKRIVQRIKDFLR LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Oral cancer LC50 : 57 µM
dbacp04172 LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay KB Oral cancer LC50 : 57 ± 3 μM
dbacp04175 LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay KB Oral cancer LC50 : 30 ± 1 μM
dbacp04178 LL-37(17-32)b FKRIVQRIKDFLRNLV LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Oral cancer LC50 : 30 µM
dbacp04349 Lytic KLlLKlLkkLLKlLKKK Bovine lactoferrin (Lf-B) Induction of apoptosis WST-1 assay KB Oral cancer IC50 : 37.4 µMol/L
dbacp04821 Nal2-S1 Ac-KKWRKWLAKK-NH2 Not found Necrosis; Apoptosis MTT assay PC9-G Oral cancer MIC : 25 μM
dbacp04823 Nal2-S1 Ac-KKWRKWLAKK-NH2 Not found Necrosis; Apoptosis MTT assay C9 Oral cancer MIC : 25 μM
dbacp04825 Nal2-S1 Ac-KKWRKWLAKK-NH2 Not found Necrosis; Apoptosis MTT assay SAS Oral cancer MIC : 25 μM
dbacp05307 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay KB Oral cancer 10.6 % inhibition of cell proliferation at 1 nM
dbacp05308 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay KB Oral cancer 18.2 % inhibition of cell proliferation at 10 nM
dbacp05309 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay KB Oral cancer 30.7 % inhibition of cell proliferation at 100 nM
dbacp05310 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay KB Oral cancer 43.1 % inhibition of cell proliferation at 1 µM
dbacp05311 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay KB Oral cancer 98.3 % inhibition of cell proliferation at 10 µM
dbacp05327 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay KB Oral cancer ED50 : 2.1 µM
dbacp05566 piscidin-1 FFHHIFRGIVHVGKTIHRLVTG Striped bass fish Inhibits angiogenesis; Apoptosis inducing; Elevation of ROS MTT/MTS assay OC2 Oral cancer IC50 : 16.94 – 19.20 μM
dbacp06009 S1 (Ac-KKWRKWLAKK-NH2) Ac-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay PC9-G Oral cancer Not found
dbacp06011 S1 (Ac-KKWRKWLAKK-NH2) Ac-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay C9 Oral cancer Not found
dbacp06013 S1 (Ac-KKWRKWLAKK-NH2) Ac-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay SAS Oral cancer Not found
dbacp06170 SVS-1 KVKVKVKVpPTKVKVKVK Bovine lactoferrin (Lf-B) Disruption of cell membranes MTT/MTS assay KB Oral cancer Not found
dbacp06174 SVS-2 KVKVKVKVPPTKVKVKVK Synthetic peptide Disruption of cell membranes MTT/MTS assay KB Oral cancer IC50 : >100 µM