36 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02628 | D-SVS-1 | kvkvkvkvPptkvkvkvk | Synthetic peptide | Disruption of cell membranes | MTT/MTS assay | KB | Oral cancer | IC50 : 4.5 ± 0.5 µM |
| dbacp02784 | dLL-37(17-32)c | FKRIVQRIKDFLRNLV | LL-37, a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Oral cancer | Not found |
| dbacp03105 | GM15 | GGTCVIRGCVPKKLM | Not found | Inducing apoptosis | MTT assay | KB | Oral cancer | Not found |
| dbacp03289 | HCAP18(109-135) | FRKSKEKIGKEFKRIVQRIKDFLRNLV | HCAP18 synthetic peptide | Apoptosis inducing | Not specified | SAS-H1 | Oral cancer | Not found |
| dbacp03375 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Bovine lactoferrin (Lf-B) | Induction of apoptosis | WST-1 assay | KB | Oral cancer | IC50 : 13.2 µMol/L |
| dbacp03396 | Interferon gamma (IFN-gamma) | MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAVKTGKRKRSQMLFRGRRASQ | Chimpanzee | Apoptosis; Immunomodulatory activity | Not specified | Not found | Oral cancer | Not found |
| dbacp03474 | K4R2-Nal2-S1 | Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | PC9-G | Oral cancer | MIC : 25 μM |
| dbacp03476 | K4R2-Nal2-S1 | Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | C9 | Oral cancer | MIC : 25 μM |
| dbacp03478 | K4R2-Nal2-S1 | Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | SAS | Oral cancer | MIC : 25 μM |
| dbacp03480 | K6-Nal2-S1 | Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | PC9-G | Oral cancer | MIC : 3.1 μM |
| dbacp03482 | K6-Nal2-S1 | Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | C9 | Oral cancer | MIC : 3.1 μM |
| dbacp03484 | K6-Nal2-S1 | Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | SAS | Oral cancer | MIC : 3.1 μM |
| dbacp04156 | LL-37(1-12) | LLGDFFRKSKEK | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Oral cancer | Not found |
| dbacp04159 | LL-37(1-4,17-27) | LLGDFKRIVQRIKDF | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Oral cancer | Not found |
| dbacp04162 | LL-37(13-37) | IGKEFKRIVQRIKDFLRNLVPRTES | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Oral cancer | LC50 : 40 µM |
| dbacp04165 | LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) | IGKEFKRIVQRIKDFLRNLVPRTES | Human | Not specified | MTT assay | KB | Oral cancer | LC50 : 40 ± 0 μM |
| dbacp04168 | LL-37(17-29) | FKRIVQRIKDFLR | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Oral cancer | LC50 : 57 µM |
| dbacp04172 | LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | KB | Oral cancer | LC50 : 57 ± 3 μM |
| dbacp04175 | LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | KB | Oral cancer | LC50 : 30 ± 1 μM |
| dbacp04178 | LL-37(17-32)b | FKRIVQRIKDFLRNLV | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Oral cancer | LC50 : 30 µM |
| dbacp04349 | Lytic | KLlLKlLkkLLKlLKKK | Bovine lactoferrin (Lf-B) | Induction of apoptosis | WST-1 assay | KB | Oral cancer | IC50 : 37.4 µMol/L |
| dbacp04821 | Nal2-S1 | Ac-KKWRKWLAKK-NH2 | Not found | Necrosis; Apoptosis | MTT assay | PC9-G | Oral cancer | MIC : 25 μM |
| dbacp04823 | Nal2-S1 | Ac-KKWRKWLAKK-NH2 | Not found | Necrosis; Apoptosis | MTT assay | C9 | Oral cancer | MIC : 25 μM |
| dbacp04825 | Nal2-S1 | Ac-KKWRKWLAKK-NH2 | Not found | Necrosis; Apoptosis | MTT assay | SAS | Oral cancer | MIC : 25 μM |
| dbacp05307 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | KB | Oral cancer | 10.6 % inhibition of cell proliferation at 1 nM |
| dbacp05308 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | KB | Oral cancer | 18.2 % inhibition of cell proliferation at 10 nM |
| dbacp05309 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | KB | Oral cancer | 30.7 % inhibition of cell proliferation at 100 nM |
| dbacp05310 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | KB | Oral cancer | 43.1 % inhibition of cell proliferation at 1 µM |
| dbacp05311 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | KB | Oral cancer | 98.3 % inhibition of cell proliferation at 10 µM |
| dbacp05327 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | KB | Oral cancer | ED50 : 2.1 µM |
| dbacp05566 | piscidin-1 | FFHHIFRGIVHVGKTIHRLVTG | Striped bass fish | Inhibits angiogenesis; Apoptosis inducing; Elevation of ROS | MTT/MTS assay | OC2 | Oral cancer | IC50 : 16.94 – 19.20 μM |
| dbacp06009 | S1 (Ac-KKWRKWLAKK-NH2) | Ac-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | PC9-G | Oral cancer | Not found |
| dbacp06011 | S1 (Ac-KKWRKWLAKK-NH2) | Ac-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | C9 | Oral cancer | Not found |
| dbacp06013 | S1 (Ac-KKWRKWLAKK-NH2) | Ac-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | SAS | Oral cancer | Not found |
| dbacp06170 | SVS-1 | KVKVKVKVpPTKVKVKVK | Bovine lactoferrin (Lf-B) | Disruption of cell membranes | MTT/MTS assay | KB | Oral cancer | Not found |
| dbacp06174 | SVS-2 | KVKVKVKVPPTKVKVKVK | Synthetic peptide | Disruption of cell membranes | MTT/MTS assay | KB | Oral cancer | IC50 : >100 µM |