dbACP: A Comprehensive Database of Anti-Cancer Peptides

4 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06019 Saha-CATH3 KRMGIFHLFWAGLRKLGNLIKNKIQQGIENFLG Tasmanian devil Pore formation on cell membrane Not specified A549 Lung cancer MIC : 500 μg/mL
dbacp06020 Saha-CATH5 KRIGLIRLIGKILRGLRRLG Tasmanian devil Pore formation on cell membrane Not specified A549 Lung cancer MIC : 500 μg/mL
dbacp06323 TP3 FIHHIIGGLFSVGKHIHSLIHGH Nile tilapia Pore formation on cell membrane In vitro cytotoxicity assay Tilapia ovary (TO2) cells Ovarian cancer MIC : > 100 µg/ml
dbacp06325 TP4 FIHHIIGGLFSAGKAIHRLIRRRRR Gills, Nile Tilapia Pore formation on cell membrane In vitro cytotoxicity assay Tilapia ovary (TO2) cells Ovarian cancer MIC : > 100 µg/ml