77 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00322 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 46.2 ± 7.6 μM |
| dbacp00323 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 46.2 ± 7.6 μM |
| dbacp00324 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 46.2 ± 7.6 μM |
| dbacp00325 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 46.2 ± 7.6 μM |
| dbacp00326 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 46.2 ± 7.6 μM |
| dbacp00362 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 51.0 ± 4.6 μM |
| dbacp00363 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 51.0 ± 4.6 μM |
| dbacp00364 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 51.0 ± 4.6 μM |
| dbacp00365 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 51.0 ± 4.6 μM |
| dbacp00366 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 51.0 ± 4.6 μM |
| dbacp00403 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 22.5 ± 3.3 μM |
| dbacp00404 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 22.5 ± 3.3 μM |
| dbacp00405 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 22.5 ± 3.3 μM |
| dbacp00406 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 22.5 ± 3.3 μM |
| dbacp00407 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 22.5 ± 3.3 μM |
| dbacp00440 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 19.5 ± 0.5 μM |
| dbacp00441 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 19.5 ± 0.5 μM |
| dbacp00442 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 19.5 ± 0.5 μM |
| dbacp00443 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 19.5 ± 0.5 μM |
| dbacp00444 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 19.5 ± 0.5 μM |
| dbacp00480 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 26.5 ± 2.4 μM |
| dbacp00481 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 26.5 ± 2.4 μM |
| dbacp00482 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 26.5 ± 2.4 μM |
| dbacp00483 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 26.5 ± 2.4 μM |
| dbacp00484 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 26.5 ± 2.4 μM |
| dbacp00520 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 29.4 ± 1.1 μM |
| dbacp00521 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 29.4 ± 1.1 μM |
| dbacp00522 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 29.4 ± 1.1 μM |
| dbacp00523 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 29.4 ± 1.1 μM |
| dbacp00524 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 29.4 ± 1.1 μM |
| dbacp00545 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 18.3 ± 1.4 μM |
| dbacp00546 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 18.3 ± 1.4 μM |
| dbacp00547 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 18.3 ± 1.4 μM |
| dbacp00548 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 18.3 ± 1.4 μM |
| dbacp00549 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 18.3 ± 1.4 μM |
| dbacp00573 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : > 64 μM |
| dbacp00574 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : > 64 μM |
| dbacp00575 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : > 64 μM |
| dbacp00576 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : > 64 μM |
| dbacp00577 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : > 64 μM |
| dbacp00621 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 30.3 ± 1.1 μM |
| dbacp00622 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 30.3 ± 1.1 μM |
| dbacp00623 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 30.3 ± 1.1 μM |
| dbacp00624 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 30.3 ± 1.1 μM |
| dbacp00625 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 30.3 ± 1.1 μM |
| dbacp00646 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 31.6 ± 1.3 μM |
| dbacp00647 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 31.6 ± 1.3 μM |
| dbacp00648 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 31.6 ± 1.3 μM |
| dbacp00649 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 31.6 ± 1.3 μM |
| dbacp00650 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 31.6 ± 1.3 μM |
| dbacp00676 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 23.3 ± 0.4 μM |
| dbacp00677 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 23.3 ± 0.4 μM |
| dbacp00678 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 23.3 ± 0.4 μM |
| dbacp00679 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 23.3 ± 0.4 μM |
| dbacp00680 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 23.3 ± 0.4 μM |
| dbacp02395 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 39.8 ± 1.0 μM |
| dbacp02396 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid leukemia | CC50 : 39.8 ± 1.0 μM |
| dbacp02397 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 39.8 ± 1.0 μM |
| dbacp02398 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 39.8 ± 1.0 μM |
| dbacp02399 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 39.8 ± 1.0 μM |
| dbacp02804 | Dolastatin 10 | 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide | Wedge sea hare | Apoptosis inducing | Cell viability assay | RL | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02808 | Dolastatin 15 | VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline | Wedge sea hare | Apoptosis inducing | Cell viability assay | RL | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp03127 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Fluorescence-based assay using a Fluorescence Imaging Plate Reader | CRL-1739 | Gastric cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03134 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03135 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid leukemia | CC50 : 67.0 ± 5.0 μM |
| dbacp03136 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03137 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03138 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp04830 | Neurotoxin BmK AGAP-SYPU2 | VKDGYIVDDKNCAYFCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGRCNG | Manchurian scorpion | Blocker of chloride channels and can inhibit the migration of glioma cells | Antitumor activity assays | Ehrlich ascites cells | Glioma | ED50 : 1.42 mg/kg |
| dbacp06803 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | CRL-1739 | Gastric Cancer | CC50 = 46.2 ± 7.6 μM |
| dbacp06809 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | CRL-1739 | Gastric Cancer | CC50 = 26.5 ± 2.4 μM |
| dbacp06815 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | CRL-1739 | Gastric Cancer | CC50 = 22.5 ± 3.3 μM |
| dbacp06819 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | CRL-1739 | Gastric Cancer | CC50 = 51.0 ± 4.6 μM |
| dbacp06825 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | CRL-1739 | Gastric Cancer | CC50 = 19.5 ± 0.5 μM |
| dbacp06831 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | CRL-1739 | Gastric Cancer | CC50 > 64 μM |
| dbacp06837 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | CRL-1739 | Gastric Cancer | CC50 = 31.6 ± 1.3 μM |
| dbacp08180 | Peptide - 1 | GF(A6c)G(A6c)KK(A6c)G(A6c)F(A6c)G(A6c)GKK(A6c)KKKK | Synthetic | Not Available | CellTiter-Glo assay | RL | Lymphoma Cancer | Not Available |