2 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp06927 | #6(M108-L127) | RRRRRRRRGGMWKGFILTVVELRVPTDLTL | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-B |
| dbacp06928 | #6(M108-L127) | RRRRRRRRGGMWKGFILTVVELRVPTDLTL | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | MCF-7 | Breast Cancer | Graph figure 1-B |