dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06927 #6(M108-L127) RRRRRRRRGGMWKGFILTVVELRVPTDLTL STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-B
dbacp06928 #6(M108-L127) RRRRRRRRGGMWKGFILTVVELRVPTDLTL STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay MCF-7 Breast Cancer Graph figure 1-B