14 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00983 | Adenoregulin | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | South American frog, Giant leaf frog | Cell membrane disintegration | LDH leakage assay | Raji | Lymphoma cancer | GI50 : 2.57 ± 0.75 µM |
| dbacp03739 | LfcinB | FKCRRWQWRMKK | Bovine lactoferrin (Lf-B) | Cell membrane disintegration; Regulation of immune response; Apoptosis | MTT/MTS assay | Raji | Lymphoma cancer | IC50 : 13 µM |
| dbacp03751 | LfcinB (Bovine lactoferricin) | FKCRRWQWRM | Not found | Inducing apoptosis | MTT assay | Raji | Leukemia | Not found |
| dbacp04294 | Lt-MAP2 | LIKKLKEYLKKLI | Derivatives of Latarcin-3a | Not specified | Not specified | Raji | Not found | Not found |
| dbacp04492 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Raji | Lymphoma cancer | IC50 : >150 µg/ml |
| dbacp04510 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Raji | Lymphoma cancer | IC50 : 20 µg/ml |
| dbacp04520 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Raji | Lymphoma cancer | IC50 : 23 µg/ml |
| dbacp04536 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Raji | Lymphoma cancer | IC50 : 25 µg/ml |
| dbacp05057 | P2 | RALGWSCL | Plant sources | Inducing apoptosis | MTS assay | Raji | Not specified | IC50 : 700 μg/Ml |
| dbacp05657 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | Raji | Colorectal cancer | IC50 : 6 μM |
| dbacp06562 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Raji | Lymphoma cancer | IC50 : 72 µg/ml |
| dbacp06578 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | Raji | Lymphoma cancer | IC50 : 64 µg/ml |
| dbacp06795 | CM11 | WKLFKKILKVL | Cecropin-Melittin Hybrid Peptide | Apoptosis inducing | MTT assay | Raji | Blood Cancer | Survival rate = 51% at 32 μg/ml |
| dbacp07345 | HMP-S7 | SFIPRAKSTWLNNIKLL | Human Milk | Membrane penetration, cytoplasmic leakage | Trypan blue assay | Raji | Lymphoma Cancer | IC50 = 89 ± 24 µM |