dbACP: A Comprehensive Database of Anti-Cancer Peptides

14 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00983 Adenoregulin GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV South American frog, Giant leaf frog Cell membrane disintegration LDH leakage assay Raji Lymphoma cancer GI50 : 2.57 ± 0.75 µM
dbacp03739 LfcinB FKCRRWQWRMKK Bovine lactoferrin (Lf-B) Cell membrane disintegration; Regulation of immune response; Apoptosis MTT/MTS assay Raji Lymphoma cancer IC50 : 13 µM
dbacp03751 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay Raji Leukemia Not found
dbacp04294 Lt-MAP2 LIKKLKEYLKKLI Derivatives of Latarcin-3a Not specified Not specified Raji Not found Not found
dbacp04492 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay Raji Lymphoma cancer IC50 : >150 µg/ml
dbacp04510 Magainin A AIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay Raji Lymphoma cancer IC50 : 20 µg/ml
dbacp04520 Magainin B GIGKFLHAAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay Raji Lymphoma cancer IC50 : 23 µg/ml
dbacp04536 Magainin G GIGKFLHSAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay Raji Lymphoma cancer IC50 : 25 µg/ml
dbacp05057 P2 RALGWSCL Plant sources Inducing apoptosis MTS assay Raji Not specified IC50 : 700 μg/Ml
dbacp05657 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay Raji Colorectal cancer IC50 : 6 μM
dbacp06562 Z24 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay Raji Lymphoma cancer IC50 : 72 µg/ml
dbacp06578 Z44 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients;Induce osmotic lysis; Membrane damage Trypan blue assay Raji Lymphoma cancer IC50 : 64 µg/ml
dbacp06795 CM11 WKLFKKILKVL Cecropin-Melittin Hybrid Peptide Apoptosis inducing MTT assay Raji Blood Cancer Survival rate = 51% at 32 μg/ml
dbacp07345 HMP-S7 SFIPRAKSTWLNNIKLL Human Milk Membrane penetration, cytoplasmic leakage Trypan blue assay Raji Lymphoma Cancer IC50 = 89 ± 24 µM