5 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp05134 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 15.74 µg/ml |
| dbacp05135 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 15.40 µg/ml |
| dbacp05136 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 14.51 µg/ml |
| dbacp05137 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 14.52 µg/ml |
| dbacp05138 | Pardaxin 4 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Interference with ionic transport of the osmoregulatory system in epithelium causing cell lysis | Not specified | Not found | Not found | Not found |