dbACP: A Comprehensive Database of Anti-Cancer Peptides

5 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05134 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 15.74 µg/ml
dbacp05135 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 15.40 µg/ml
dbacp05136 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 14.51 µg/ml
dbacp05137 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 14.52 µg/ml
dbacp05138 Pardaxin 4 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Interference with ionic transport of the osmoregulatory system in epithelium causing cell lysis Not specified Not found Not found Not found