15 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02038 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | SK-OV-3 | Ovarian cancer | IC50 : 12.6 µg/ml |
| dbacp02595 | Cyclic [W(RW)4 ]-Dox | WRWRWRWRW | Not found | Inhibition of the cell proliferation | MTT/MTS assay | SK-OV-3 | Ovarian cancer | 51-74% inhibition of cell proliferation at 1 µM |
| dbacp02978 | GA-K3 | FLGWLFKWAKK | Undecapeptide analogues derived from Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | SK-OV-3 | Ovarian cancer | IC50 : 27.39 µM |
| dbacp02985 | GA-K3 | FLKWLFKWAKK | Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | SK-OV-3 | Ovarian cancer | IC50 : 24.76 µM |
| dbacp02992 | GA-K4 | FLKWLFKWAKK | Undecapeptide analogues derived from Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | SK-OV-3 | Ovarian cancer | IC50 :12.55 µM |
| dbacp02999 | GA-K4 | FLKWLFKWAKK | Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | SK-OV-3 | Ovarian cancer | IC50 : 12.55 µM |
| dbacp03006 | GA-W3 | FLGWLFKWAWK | Undecapeptide analogues derived from Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | SK-OV-3 | Ovarian cancer | IC50 : 22.06 µM |
| dbacp03013 | GA-W3 | FLGWLFKWAWK | Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | SK-OV-3 | Ovarian cancer | IC50 : 22.06 µM |
| dbacp03020 | GA-W4 | FLWWLFKWAWK | Undecapeptide analogues derived from Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | SK-OV-3 | Ovarian cancer | IC50 : 14.58 µM |
| dbacp03027 | GA-W4 | FLWWLFKWAWK | Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | SK-OV-3 | Ovarian cancer | IC50 : 14.58 µM |
| dbacp04104 | linear (RW)4-Dox | RWRWRWRW | Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP | Inhibition of the cell proliferation | MTT/MTS assay | SK-OV-3 | Ovarian cancer | 28-34% anti-proliferative activity at 1 µM |
| dbacp06756 | 37-mer peptide | TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC | Synthetic | Apoptosis inducing | MTT assay | SK-OV-3 | Ovarian cancer | IC50 = 27.45 ± 1.5085 μM |
| dbacp07538 | AEM-28 | LRKLRKRLLRDWLKAFYDKVAEKLKEAF | Synthetic | LPA reduction suppresses tumor growth | MTS assay | SK-OV-3 | Ovarian Cancer | ~50% cell viability at 10 μg/mL |
| dbacp07544 | AEM-28–2 | Aha-LRRLRRRLLRDWLKAFYDKVAEKLKEAF | Synthetic | LPA reduction suppresses tumor growth | MTS assay | SK-OV-3 | Ovarian Cancer | ~30% cell viability at 10 μg/mL |
| dbacp08293 | L-Carnosine | Beta-AH | Synthetic | Not Available | MTT assay | SK-OV-3 | Ovarian Cancer | IC50 = 485 mM |