dbACP: A Comprehensive Database of Anti-Cancer Peptides

15 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02038 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay SK-OV-3 Ovarian cancer IC50 : 12.6 µg/ml
dbacp02595 Cyclic [W(RW)4 ]-Dox WRWRWRWRW Not found Inhibition of the cell proliferation MTT/MTS assay SK-OV-3 Ovarian cancer 51-74% inhibition of cell proliferation at 1 µM
dbacp02978 GA-K3 FLGWLFKWAKK Undecapeptide analogues derived from Brevinin-1EMa Cell membrane disruption MTT/MTS assay SK-OV-3 Ovarian cancer IC50 : 27.39 µM
dbacp02985 GA-K3 FLKWLFKWAKK Brevinin-1EMa Cell membrane disruption MTT/MTS assay SK-OV-3 Ovarian cancer IC50 : 24.76 µM
dbacp02992 GA-K4 FLKWLFKWAKK Undecapeptide analogues derived from Brevinin-1EMa Cell membrane disruption MTT/MTS assay SK-OV-3 Ovarian cancer IC50 :12.55 µM
dbacp02999 GA-K4 FLKWLFKWAKK Brevinin-1EMa Cell membrane disruption MTT/MTS assay SK-OV-3 Ovarian cancer IC50 : 12.55 µM
dbacp03006 GA-W3 FLGWLFKWAWK Undecapeptide analogues derived from Brevinin-1EMa Cell membrane disruption MTT/MTS assay SK-OV-3 Ovarian cancer IC50 : 22.06 µM
dbacp03013 GA-W3 FLGWLFKWAWK Brevinin-1EMa Cell membrane disruption MTT/MTS assay SK-OV-3 Ovarian cancer IC50 : 22.06 µM
dbacp03020 GA-W4 FLWWLFKWAWK Undecapeptide analogues derived from Brevinin-1EMa Cell membrane disruption MTT/MTS assay SK-OV-3 Ovarian cancer IC50 : 14.58 µM
dbacp03027 GA-W4 FLWWLFKWAWK Brevinin-1EMa Cell membrane disruption MTT/MTS assay SK-OV-3 Ovarian cancer IC50 : 14.58 µM
dbacp04104 linear (RW)4-Dox RWRWRWRW Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP Inhibition of the cell proliferation MTT/MTS assay SK-OV-3 Ovarian cancer 28-34% anti-proliferative activity at 1 µM
dbacp06756 37-mer peptide TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC Synthetic Apoptosis inducing MTT assay SK-OV-3 Ovarian cancer IC50 = 27.45 ± 1.5085 μM
dbacp07538 AEM-28 LRKLRKRLLRDWLKAFYDKVAEKLKEAF Synthetic LPA reduction suppresses tumor growth MTS assay SK-OV-3 Ovarian Cancer ~50% cell viability at 10 μg/mL
dbacp07544 AEM-28–2 Aha-LRRLRRRLLRDWLKAFYDKVAEKLKEAF Synthetic LPA reduction suppresses tumor growth MTS assay SK-OV-3 Ovarian Cancer ~30% cell viability at 10 μg/mL
dbacp08293 L-Carnosine Beta-AH Synthetic Not Available MTT assay SK-OV-3 Ovarian Cancer IC50 = 485 mM